KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1622
Entry
ECBD_1622         CDS       T00939                                 

Definition
(GenBank) hypothetical protein
  KO
K23198  O7-antigen biosynthesis rhamnosyltransferase
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    ECBD_1622
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ebd01005]
    ECBD_1622
Lipopolysaccharide biosynthesis proteins [BR:ebd01005]
 O-antigen repeat unit
  ECBD_1622
SSDB
Motif
Pfam: DUF5889
Other DBs
NCBI-ProteinID: ACT28681
UniProt: A0A140NAC1
LinkDB
Position
1735059..1735880
AA seq 273 aa
MDCKKKLCIVACSYTLKPEFIINKLYNYLPDYELDGVVISNNHIVEQITMKGFHIENGTN
SLFEFSAYKEGIDFLEDSSLLPSGVPILILNDTLFLKHNAKFFLRKIVSYYSTIQRTELP
TMAGRLDPYNNICYSNSWNNMNGYISSFCMLINEKSAKIIVSCYNELPKYFFSNDIDIID
PKWGMQIESRLREFIRSHLIDIDTDTVWYQAKLLHNDKQRINIKAQCVFMEHFISGKIGE
SGIVVSIFPTWKGKVLNFLNEQLAKIKRKIIIK
NT seq 822 nt   +upstreamnt  +downstreamnt
atggattgtaaaaaaaaattatgcattgtggcctgttcttatactttaaagccagaattc
ataattaataaattatataattatttaccagattatgaactagatggtgttgtgatttcc
aataatcatatagtagaacagattacaatgaagggatttcatatcgaaaacgggacaaat
tctctttttgagttttctgcctataaggaaggaatagattttttagaagatagctcatta
ttaccatcaggagtaccaattctcattttgaatgatacattgttcttgaaacataatgca
aaattctttttaaggaaaattgtgagttattattcaacaattcaaagaactgaattgcct
acaatggcaggtcgtttagatccttataataatatatgttacagtaactcttggaataat
atgaatggctatatatcttccttttgtatgctaataaatgaaaaatctgcaaaaataatt
gttagttgctacaatgagcttccaaaatatttttttagtaatgatattgatattattgac
cccaaatggggaatgcagattgaatcaagactgagagaatttattcgtagtcatttaatt
gatatagacacagatacggtttggtatcaagctaaattgttacataatgataaacaacga
attaatattaaagctcaatgtgtcttcatggaacatttcatatcagggaagattggtgaa
agtggaattgttgtttctatttttcccacatggaaaggaaaggtgttaaattttttaaac
gagcaattggctaaaatcaagaggaagattataattaaatga

DBGET integrated database retrieval system