KEGG   Escherichia coli BL21(DE3): B21_01928
Entry
B21_01928         CDS       T02096                                 

Gene name
wbbB
Definition
(GenBank) WbbB
  KO
K23198  O7-antigen biosynthesis rhamnosyltransferase
Organism
ebe  Escherichia coli BL21(DE3)
Pathway
ebe00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:ebe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    B21_01928 (wbbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ebe01005]
    B21_01928 (wbbB)
Lipopolysaccharide biosynthesis proteins [BR:ebe01005]
 O-antigen repeat unit
  B21_01928 (wbbB)
SSDB
Motif
Pfam: DUF5889
Other DBs
NCBI-ProteinID: CAQ32445
LinkDB
Position
complement(2003922..2004743)
AA seq 273 aa
MDCKKKLCIVACSYTLKPEFIINKLYNYLPDYELDGVVISNNHIVEQITMKGFHIENGTN
SLFEFSAYKEGIDFLEDSSLLPSGVPILILNDTLFLKHNAKFFLRKIVSYYSTIQRTELP
TMAGRLDPYNNICYSNSWNNMNGYISSFCMLINEKSAKIIVSCYNELPKYFFSNDIDIID
PKWGMQIESRLREFIRSHLIDIDTDTVWYQAKLLHNDKQRINIKAQCVFMEHFISGKIGE
SGIVVSIFPTWKGKVLNFLNEQLAKIKRKIIIK
NT seq 822 nt   +upstreamnt  +downstreamnt
atggattgtaaaaaaaaattatgcattgtggcctgttcttatactttaaagccagaattc
ataattaataaattatataattatttaccagattatgaactagatggtgttgtgatttcc
aataatcatatagtagaacagattacaatgaagggatttcatatcgaaaacgggacaaat
tctctttttgagttttctgcctataaggaaggaatagattttttagaagatagctcatta
ttaccatcaggagtaccaattctcattttgaatgatacattgttcttgaaacataatgca
aaattctttttaaggaaaattgtgagttattattcaacaattcaaagaactgaattgcct
acaatggcaggtcgtttagatccttataataatatatgttacagtaactcttggaataat
atgaatggctatatatcttccttttgtatgctaataaatgaaaaatctgcaaaaataatt
gttagttgctacaatgagcttccaaaatatttttttagtaatgatattgatattattgac
cccaaatggggaatgcagattgaatcaagactgagagaatttattcgtagtcatttaatt
gatatagacacagatacggtttggtatcaagctaaattgttacataatgataaacaacga
attaatattaaagctcaatgtgtcttcatggaacatttcatatcagggaagattggtgaa
agtggaattgttgtttctatttttcccacatggaaaggaaaggtgttaaattttttaaac
gagcaattggctaaaatcaagaggaagattataattaaatga

DBGET integrated database retrieval system