Erwinia billingiae: EbC_15900 Help Entry EbC_15900         CDS       T01270                                  Name (GenBank) Putative acyl carrier protein   KO K02078   acyl carrier protein Organism ebi  Erwinia billingiae Pathway ebi01100   Metabolic pathways ebi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ebi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EbC_15900   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EbC_15900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAX59121 UniProt:  D8MQL4 LinkDB All DBs Position 1794498..1794764 Genome browser AA seq 88 aa AA seqDB search MEELALEIKQMIIDTLNLEEIAAEEIDSEAPLFGDGLGLDSIDALELGLAVKNRYGVVLS AESEEMRQHFYSVFTLAAFILSQRKLGA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaagagctagcgcttgaaataaaacagatgatcatcgacaccctcaatctggaagag attgccgcggaagagatcgacagcgaagccccgttattcggcgacggactggggctggac tcaatcgatgcgctggaacttggcctggcggtgaaaaatcgctacggcgtggtgctctcc gccgagagcgaggagatgcgtcagcatttttattccgtcttcacgctggcggcctttatc ctcagccagcgcaagctgggtgcctga

DBGET integrated database retrieval system