KEGG   Erigeron canadensis (horseweed): 122602228
Entry
122602228         CDS       T07610                                 
Name
(RefSeq) costunolide synthase-like
  KO
K20561  costunolide synthase [EC:1.14.14.150]
Organism
ecad  Erigeron canadensis (horseweed)
Pathway
ecad00909  Sesquiterpenoid and triterpenoid biosynthesis
ecad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecad00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    122602228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ecad00199]
    122602228
Enzymes [BR:ecad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.150  costunolide synthase
     122602228
Cytochrome P450 [BR:ecad00199]
 Cytochrome P450, plant type
  CYP71 family
   122602228
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 122602228
NCBI-ProteinID: XP_043630876
LinkDB
Position
5:complement(7348383..7350174)
AA seq 498 aa
MESLPIFSLIAYLLVILTTFWAFIKPKSSKKLPPGPPKLPIIGNIHQLKGASPHRVLRSL
ARKYGAPFMHLQIGQVSTVVVSNPRLAQEILTTYDHIFSDRPVTTASQILFYKGQDIVWA
PRGKYWRQMRKICTLELLSPKRVQTYSYIREEELIRMRMSLELSTGRPVIIREMVVEMVN
NVICRATVGDICKDRKILIEVLYDIVKALSAFNLASYFPTMQFLKVILGKKSKWLKRQKQ
LDTILEDILKEHQNRPSSNNDDQEDLVDVLLRVQKTGHLDLPITKDNIKGVILDMLIAGT
STSAMVLEWAMCELMRNPEMMKKVQAELRDTVKGNTIVEVDIQNMPYLKLVVKETLRLHG
SLLLVPRENKVDCQVDGYHIPAKTRLLINSWACGTDPEYWENPESFIPERFEKSSISYLG
ADYQLIPFGAGRRVCPGANFGLAIIELALATLLYYFNWELPNGLKPDDVDLTEAFMISSL
PKHPLQVVPVTMSSLLAD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggaatctcttcccatcttctccttaattgcttatttgctagttatcttaactactttt
tgggcattcataaaacccaagtcatcaaaaaagttaccaccaggacccccaaaacttcct
attattggaaacatacaccaactcaaaggtgcatccccccatcgagttctaagaagcttg
gctaggaaatatggcgccccctttatgcatttacagataggtcaagtttctaccgtggtc
gtatccaatccaagactagcccaagagattttaacgacctatgatcacatattttccgat
agaccagtcacaacagcctcccaaatcctattttataaaggtcaagacattgtatgggct
cctcgtgggaagtattggaggcaaatgaggaagatttgtactttggaactacttagccct
aagagggtccaaacctatagttatattcgagaagaggagcttattcgtatgcgtatgtct
cttgagttatcaaccggaagacctgttataataagggaaatggtggtagagatggtgaac
aatgtgatttgtagggctacagttggagatatatgtaaagaccgaaagatactcatagaa
gtactctatgatatagtgaaagctttgagtgctttcaacttggcttcatatttccctact
atgcaatttcttaaagttattctagggaagaaatcaaagtggttaaagaggcagaaacaa
ctcgatactatcttagaagacatcttgaaagaacaccaaaatcgaccaagtagcaacaat
gatgatcaagaagatctggttgatgttctcttaagagtccaaaaaactggtcatttagat
cttcccataacaaaagataatatcaaaggcgtcattctggatatgttgatagctgggacc
agtacctctgcaatggtgcttgaatgggcaatgtgcgaactgatgagaaacccagagatg
atgaagaaagtacaagctgaactaagggacacggtgaagggcaatacgatagtagaagtg
gacatacaaaacatgccttacttgaagttagtagtaaaggaaacattaaggttacatggt
tcacttttgttggttcccagagagaataaggtggattgccaagttgatggataccatatc
ccagcaaagacaaggttacttataaattcatgggcatgcggaacagatcccgaatattgg
gaaaatcctgaaagcttcatcccggaaagatttgaaaagagttctataagttacttgggt
gccgactatcaactcattccttttggagctggcaggagagtgtgtcctggtgctaatttt
gggctagctatcattgaattggcacttgctactcttctgtactatttcaattgggagctt
ccaaacgggttgaagccagatgatgtcgatctgacagaagctttcatgatttcgtcatta
cctaaacatcctttacaggttgttcctgtcaccatgtcgtctttgcttgcagactaa

DBGET integrated database retrieval system