KEGG   Equus caballus (horse): 100063927
Entry
100063927         CDS       T01058                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04927  Cortisol synthesis and secretion
ecb04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100063927 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100063927 (MRAP)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 100063927
NCBI-ProteinID: XP_005606289
Ensembl: ENSECAG00000012808
VGNC: 20305
UniProt: A0A5F5PZ89
LinkDB
Position
26:30339802..30360659
AA seq 219 aa
MESSACIVKLSGPPPTFLPVHGSDKWAGLEPGDPQTHWMVLQKSVRPSPRRAPRSSRCAA
DMANQTNTSAPFYSYEYYLDYLDLIPVDERKLKANKHSIVIVFWVSLAAFVVLLFLILLY
MSWSGSPQMRDNTQHHPTCPWSHSLNLPFCVRRHPPHHRDPRGTPQAPPSSAEEPGSRAS
GRDQQPQGESPSALSPTAPQAHCALLWELTPDGDPHRVS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagagctctgcttgcatagtgaagctgtcaggcccacccccgacctttctcccagtc
cacggctctgataagtgggcaggccttgagcctggagacccacagacacactggatggtt
ttacagaaatcagtgaggccgtctcctcgtagggctccgaggagctccaggtgcgctgca
gacatggccaaccagaccaacacctccgccccattctacagctacgaatattacctggac
tacctggacctcattcccgtggatgagaggaagctgaaagccaacaagcattccatcgtc
atcgtcttctgggtgagcctggcggccttcgtggtgcttctcttcctcatcctgctctac
atgtcctggtcgggctccccgcagatgagggacaacacccagcaccacccaacatgtccc
tggagtcacagcctcaacctccccttctgtgtccggaggcacccaccgcaccacagggac
cctcgggggaccccgcaggctccaccgagctcggctgaggaaccaggcagcagagcatcc
ggccgcgatcagcagccgcagggagagagcccctctgccttgtcccccacagccccccag
gcccactgtgccctcctctgggaactgacccctgatggggacccccaccgcgtcagctga

DBGET integrated database retrieval system