KEGG   Equus caballus (horse): 100064779
Entry
100064779         CDS       T01058                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X precursor
  KO
K06462  integrin alpha X
Organism
ecb  Equus caballus (horse)
Pathway
ecb04610  Complement and coagulation cascades
ecb04810  Regulation of actin cytoskeleton
ecb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100064779 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100064779 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100064779 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ecb04515]
    100064779 (ITGAX)
   04090 CD molecules [BR:ecb04090]
    100064779 (ITGAX)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100064779 (ITGAX)
CD molecules [BR:ecb04090]
 Proteins
  100064779 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 VWA_CoxE Integrin_alpha
Other DBs
NCBI-GeneID: 100064779
NCBI-ProteinID: NP_001107649
Ensembl: ENSECAG00000024082
VGNC: 51160
UniProt: B0F6U5
LinkDB
Position
13:complement(19602166..19622998)
AA seq 1160 aa
MTRTRTSLLLLMALASSLCFNLDMDQPTTFRMDSAGFGHSVVQYANSWVVVGAPQEIKAT
NQTGGLYQCDYSTASCEPIPLQVPPEAVNMSLGLSLAAATNPSQLLACGPTVHHTCRENV
YLTGFCFLLASGSWQAQRLPAALQECPRQEHDIVFLIDGSGSIYFKDFAKMLSFVKAVMS
QFQRPSTQFSLMQFSNKFLVHFTFKDFMDSSDPLGLLNSVSQLRGLTHTASAIQVVIKEL
FSATRGARKDASKILIVITDGQKQGDYLGYDDVIPMAEAAGIIRYAVGVGSAFQSTQAWQ
ELNDIASKPSHEHIFKVDDFDALRDIQNQLKEKIFAIEGTQTVSSSSFELEMSQEGFSTV
FTPDGPVLGAVGSFDWSGGAFLYPPKMSPTFINVSQEEVDMRDSYLGYSTELATWQGVQS
LVLGAPRHQHTGKVFIFTQHPGSGGPKANVIGTQIGSYFGASLCTVDVDRDGSSDLVLIG
APHYYMQTQGGQVSVCPLPRGRAKWQCEAVLRGEQGHPWGRFGAALTVLGDVNGDKLMDV
AIGAPGEQENQGAVYLFHGTSGLGISPSHSQRIAASQLSPRLQYFGQSLSGGQDLTMDGL
VDLAVGAQGHALLLRTRPVLRVWVSIRITPAEIARSVFECQEQEPSVRTLGDADVCLRIY
ESPKNRLGDLQSSVTFDLTLDPGRMNPRAIFEETKTWNLTRVRVLGLNQHCETVKLLLLA
CVEDTVTPITLRLNFSLEGKPIPSFGSIRPVLAVDAQRYFTASLPFEKNCGADHVCQDDL
GISFHFSGLKTLVVGNNLELNMEVTVRNDGEDSYGTTVTFFYPPGLSYRRVAEGQNQLQP
RSLRLTCDSAPADGQGTWRTRCSINHLILREGAQITFTATFDVSPKAVLGDRLLLTANVS
SENNTPRTSKTTFQLELPVKYAVYIVIHSPEQSTKYLNFSASEEKESSRAQHRCQVNNLG
QRDLPVSINFLVPVELNRVAVWTEMEVFHPQNPAIQCPSERIAPTESDFLTHLQKNPVLD
CSIADCLRFRCDIPSFGIREELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFNRSVYSQ
LPGQEAFLRAQMEMVLEKYEVYNPIPVIVGSSVGGLLLLALITAILYKVGFFKRQYKEMM
REANGHTVPENGTSDPQVAQ
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgaccaggaccaggacatctctcctcctgttgatggccttggcttcctctctctgcttc
aacttggacatggaccagccaacaactttccgcatggacagtgctgggtttggacacagc
gtggtccagtacgccaactcctgggtggtggttggagccccccaggagataaaggctaca
aaccaaacaggcggcctttaccagtgtgactacagcacagcctcatgtgagcccatcccc
ctgcaggtccccccagaggctgtgaacatgtccttgggcctgtccctggcggctgccacc
aacccctctcagctgctggcctgtggccctaccgtgcaccacacctgcagagagaatgtg
tacttgaccgggttctgcttcctgctggcctccggatcctggcaggcccagaggctcccc
gctgccctgcaggagtgcccgaggcaagagcacgacattgtgttcctgatagacggctca
ggcagcatctacttcaaggattttgccaagatgctgagcttcgtgaaggctgtgatgagc
cagttccagagacccagcacccagttctccctgatgcagttctccaacaaattcctcgtg
cacttcactttcaaagacttcatggacagctcagacccactaggcctgttgaattctgta
tcccagctgagagggttgactcacacagcctcagccatccaggtggtcataaaagaactg
ttcagtgctacaagaggggcccgaaaggatgcctccaagatcctcatcgtcatcaccgat
gggcagaaacaaggcgactacctgggttatgacgatgtcatccccatggctgaggcagca
ggcatcatccgttacgcagttggggtgggatcggcttttcaaagcacacaagcctggcaa
gaattaaatgacattgcatcgaagccctcccatgaacatatatttaaagtggatgacttt
gatgctttgagagacattcaaaaccaattgaaagagaagatctttgccattgagggtacg
cagactgtaagcagtagttcctttgaattggagatgtcccaggagggcttcagcactgtg
ttcacgcctgacgggccagttttgggggctgtgggaagctttgactggtctggaggtgcc
ttcctatacccaccaaagatgagccccaccttcatcaacgtgtctcaggaggaagtggac
atgagagactcttacctgggttactccaccgagctggccacttggcagggggtgcagagc
ctggtcctgggggccccccgccatcagcacaccgggaaggttttcatcttcacccagcat
ccaggaagtggaggcccaaaggctaacgtcataggcactcagatcggctcctacttcggg
gccagtctgtgcaccgttgacgtggacagagacggaagctctgacctggtcctcatcggg
gctccccactactatatgcagacgcaggggggccaggtgtctgtgtgccccttgccccgg
gggagggccaagtggcagtgtgaggctgttctccgtggggagcagggccacccctggggc
cgctttggggcagccctgacagtactcggggatgtgaatggggacaagctgatggacgtg
gccatcggggcccccggagagcaggagaaccagggtgctgtctacctatttcatggaacc
tcaggactgggcatcagcccctcccacagccagaggattgcagcctcccagctctccccc
aggctccagtattttgggcagtcgctgagtgggggtcaggatctcaccatggatggactg
gtggacctggctgtgggggcccaggggcacgcgctgctgctcaggactagacccgtgctt
agggtgtgggtgagcatccgcatcacacctgcagagattgccaggtctgtgtttgagtgt
caggagcaggagccctctgtccgtaccctgggtgacgccgatgtctgccttcgtatttat
gaaagtcccaagaaccggctgggtgacctccaaagctctgtgacctttgacctgaccctt
gatcctggccgcatgaatccccgtgccatctttgaggagacaaagacctggaatctgact
cgtgtccgagtccttgggctgaaccagcactgtgagaccgtgaagttgctcctcctggcc
tgtgtggaggacacagtgacccccatcaccttgcgtctcaacttctccctggagggcaag
cccatcccttcctttggaagcatccggcctgtgctggctgtggatgctcagagatacttc
acagcctctctcccctttgagaagaactgtggagctgaccatgtctgccaggacgacctt
ggcatctcctttcacttctcaggcttgaagacgctggtggtggggaataacctggagctg
aacatggaagtgacagtgcgaaatgacggcgaggactcctatggaaccacagttaccttt
ttctaccctccagggctgtcttatcgacgtgtggcagagggccagaaccagctgcagcca
cgctcgctgcgcctgacctgtgacagtgcccctgccgatgggcagggcacttggaggacc
cgctgtagcatcaaccacctcatcttgcgtgagggcgcccagatcacattcacggccacg
tttgacgtctcccccaaggctgtgctaggagaccggcttcttttgacggccaatgtgagc
agtgagaataacacccccaggaccagcaagaccaccttccagctggagctcccagtgaag
tacgctgtctacatcgtgatccacagccctgaacaatccaccaagtacctcaacttctca
gcctcagaggagaaggaaagcagcagggcccagcatagatgtcaggtgaacaacctggga
caaagggacctgcctgtcagcatcaacttcttggtgcctgtggagctgaaccgggtggct
gtatggacagagatggaggtcttccacccccagaatccagccattcagtgtccttcagag
agaatagcacccacagagtctgatttcctgacccaccttcagaagaatcctgtgctggac
tgctccattgctgactgcctgaggttccgctgtgacatcccctccttcggcatccgggag
gaacttgacttcatcctgaagggcaaccttagctttggttgggtcagccagacattgcag
aagaaagtattggtcgtgagtgtggccgaaatcacgttcaacagatctgtgtattcgcag
cttccaggacaggaggcatttttgagagcccagatggagatggtgctagagaagtatgag
gtctacaaccccatccccgttattgtgggcagctctgtgggaggactgctgctgctggct
ctcattacagccatactgtacaaggttggcttcttcaaacgtcagtacaaggaaatgatg
cgggaagcaaatggacacactgtcccagaaaatgggacatcagacccccaagttgcccaa
taa

DBGET integrated database retrieval system