Equus caballus (horse): 100071136 Help Entry 100071136         CDS       T01058                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism ecb  Equus caballus (horse) Pathway ecb04144   Endocytosis ecb04510   Focal adhesion ecb05020   Prion disease ecb05100   Bacterial invasion of epithelial cells ecb05205   Proteoglycans in cancer ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100071136 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100071136 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100071136 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100071136 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     100071136 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100071136 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100071136 (CAV2) Membrane trafficking [BR:ecb04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100071136 (CAV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100071136 NCBI-ProteinID:  NP_001107616 Ensembl:  ENSECAG00000002266 VGNC:  16087 UniProt:  Q2QLB1 LinkDB All DBs Position 4:73861623..73869976 Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFLDDESYSRHSGVDYADPEKFADAGLDRDPHRLNSHLKVGFEDVIAEP VSTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFVAGILFATLSCLHIWIIMPFVK TCLMLLPSVQTIWKSVTDVVIAPLCTSAGRSFSSVSLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggcggacgtgcagctcttcctggacgacgaatcctacagc cgccatagcggcgtcgactacgccgaccccgagaagtttgcggacgcgggcctcgaccgg gatccccatcggctcaactcgcatctcaaggtgggcttcgaggatgtgatcgcagagccg gtgtctacgcactcctttgacaaagtgtggatctgcagccatgcgctctttgaaatcagc aaatacgtgatttacaagttcctgacggtgttccttgctatccccctggccttcgttgcg ggaattctctttgccaccctcagctgtctgcatatctggattataatgccttttgtaaag acctgcctaatgctcctgccttcagtgcagacaatctggaagagtgtgaccgatgtcgtc attgccccattgtgtacaagcgcgggacgcagcttctcttctgtcagcttacaactgagc cacgactga

DBGET integrated database retrieval system