KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1041
Entry
E2348C_1041       CDS       T00796                                 
Name
(GenBank) T3SS effector-like protein NleB homolog
  KO
K23657  T3SS secreted effector NleB
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_1041
SSDB
Motif
Pfam: SidC_lipid-bd
Other DBs
NCBI-ProteinID: CAS08589
UniProt: B7UNX3
LinkDB
Position
1085343..1086323
AA seq 326 aa
MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVP
IVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVD
FSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHA
WFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHV
DRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNY
NHFCDFIEFNHPNIIMNTSQYTCSSW
NT seq 981 nt   +upstreamnt  +downstreamnt
atgctttcaccgataaggacaactttccataactcagtaaatatagtgcagagttcaccc
tgtcaaacggtttcttttgcaggaaaggaatatgagttaaaggtcattgatgaaaaaacg
cctattctttttcagtggtttgaacctaatcctgaacgatataagaaagatgaggttcca
atagttaatactaagcagcatccctatttagataatgtcacaaatgcggcaaggatagag
agtgatcgtatgataggtatttttgttgatggcgatttttcagtcaaccaaaagactgct
ttttcaaaattggaacgagattttgaaaatgtaatgataatctatcgggaagatgttgac
ttcagtatgtatgacagaaaactatcagatatttatcatgatattatatgtgaacaaagg
ttacgaactgaagacaaaagagatgaatacttgttgaatctgttagagaaagagctgagg
gaaatttcaaaggcgcaggattctttgatttctatgtatgcaaagaaaagaaatcatgca
tggtttgatttcttcagaaatttagccttattaaaagcaggagagatattcaggtgcaca
tataatacaaagaatcacggtatttcattcggggaggggtgtatctatcttgatatggat
atgatacttacaggtaagcttggtacaatatatgctcctgatggaatttcaatgcatgtg
gatcgtcgtaatgatagtgtaaatattgaaaatagtgcaataattgttaaccgtagtaat
catcctgctctacttgagggactttcttttatgcatagtaaagtagatgctcatccatat
tatgatggtttggggaaaggagttaagaaatattttaattttacaccattacataattat
aatcatttttgtgactttattgagtttaaccaccctaatataatcatgaacacaagtcag
tatacatgcagttcatggtaa

KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3231
Entry
E2348C_3231       CDS       T00796                                 
Name
(GenBank) T3SS secreted effector NleB homolog
  KO
K23657  T3SS secreted effector NleB
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_3231
SSDB
Motif
Pfam: SidC_lipid-bd SipA_2nd
Other DBs
NCBI-ProteinID: CAS10779
UniProt: B7UI21
LinkDB
Position
3350278..3351267
AA seq 329 aa
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKG
EVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRA
DVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKR
EHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIA
VHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSL
HNYNAFCDFIEFKHENIIPNTSMYTSSSW
NT seq 990 nt   +upstreamnt  +downstreamnt
atgttatcttcattaaatgtccttcaatccagcttcagaggaaagacagctttatcaaat
agtacacttctccagaaagtttcttttgctggaaaagaatattctctggaacctattgat
gaaagaacccctattctttttcagtggtttgaagcaaggccagagcgatacgaaaaagga
gaagtaccaatattgaataccaaagaacatccgtatttgagcaatattataaatgctgca
aaaatagaaaatgagcgtataatcggtgtgctggtagatggaaattttacttatgaacaa
aaaaaggaatttctcaatcttgaaaatgaacatcaaaatataaaaataatctaccgagca
gatgtggatttcagcatgtatgataaaaaactatctgatatttaccttgaaaatatccat
aaacaagaatcataccctgccagtgagagggataattatctgttaggcttattaagagaa
gagttaaaaaatatcccagaaggtaaggactctttgattgagtcatatgcagaaaaaaga
gaacatacttggtttgattttttcaggaatttggccatattgaaggctggaagtttgttt
acagagacgggaaaaactggatgccataacatatcgccctgtagcggatgtatatatctt
gatgccgacatgattattaccgataaattaggagtcctgtatgctcctgatggtatcgct
gtgcatgtagattgtaatgatgagataaaaagtcttgaaaatggtgcgatagttgtcaat
cgtagtaatcatccagcattacttgcaggcctcgatattatgaagagtaaagttgacgct
catccatattatgatggtctaggaaagggtatcaagcggcattttaactattcatcgtta
cacaattataatgctttttgtgattttattgaatttaagcatgaaaatattataccgaat
accagtatgtataccagcagttcatggtaa

DBGET integrated database retrieval system