KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1042
Entry
E2348C_1042       CDS       T00796                                 
Name
(GenBank) T3SS secreted effector NleC homolog
  KO
K23655  T3SS secreted effector NleC
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_1042
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecg01002]
    E2348C_1042
Peptidases and inhibitors [BR:ecg01002]
 Metallo peptidases
  Family M85
   E2348C_1042
SSDB
Motif
Pfam: Peptidase_M85
Other DBs
NCBI-ProteinID: CAS08590
UniProt: B7UNX4
LinkDB
Position
1086384..1087376
AA seq 330 aa
MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAV
HDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEES
SVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPYVSFSVAPDTDSYEMPSWQEG
LIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN
LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAIN
DNLQDANQIQLYHGAPYIFTFGDVDKHNQR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaaattccctcattacagtccaacttcaacttttccgccccggcaggatactctgct
cccattgctcctaatcgtgctgaaaatgcctatgcggattacgttttggatataggtaag
cgaataccactttccgcagcagatttaagcaacgtatacgaaagtgtaatacgcgccgtc
catgacagccgtagcaggcttatcgatcagcatacagtcgatatgatcggcaacactgta
cttgatgctttgagccgatcacagacatttcgtgatgccgtaagctatggcattcataat
gagaaggtacacattggttgcattaaatacagaaacgaatacgagcttaacgaagaatct
tctgtcaaaattgatgatattcaatcactaacctgtaacgaattatatgaatatgatgtc
gggcaagagccaattttccccatttgcgaagcaggagaaaacgataacgaagagccttat
gtcagttttagtgttgcgccagatactgactcttatgagatgccatcgtggcaggaagga
ctgattcacgagattattcatcatgttactggatctagcgatccatctggagatagtaat
atagagttaggacccaccgagattctcgcacgtcgtgtcgctcaagaactgggatggagt
gttcccgacttcaaaggatatgcagagccagaacgtgaagctcatcttaggttacgtaac
ctgaatgcccttcgacaggctgccatgaggcatgaagagaatgagagggctttcttcgaa
aggctgggtacgatcagtgaccgatatgaggcgagtcctgatttcacagagtattccgct
gtgtctaacataggatacggatttatccagcaacatgattttcctggattggctatcaac
gataatttacaggatgcaaatcagatccaactgtatcatggcgccccttatatttttaca
tttggggatgtggacaaacacaatcagcgatga

DBGET integrated database retrieval system