KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_2916
Entry
E2348C_2916       CDS       T00796                                 
Name
(GenBank) T3SS secreted effector EspG homolog
  KO
K12809  T3SS secreted effector EspG-like protein
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_2916
SSDB
Motif
Pfam: EspG DUF4520
Other DBs
NCBI-ProteinID: CAS10464
UniProt: B7UH72
LinkDB
Position
complement(3009981..3011153)
AA seq 390 aa
MINGISQLRSIQSNSAQSNSALFALESVLDVSSYLENNWSDKPWAERILSYLGLSHCRSE
YKGDDRLLLDVLSILKPILPSSNEAGKVQASFSDGSRLTISVTKSELIEIAVTTPEGDEV
SIFPERNKQDCLLKSLPVALHMPYIKKHHSLPEIEVNGADGMRFLCNFAAKLSTAIVPYS
EKTNPLSGVSPLNSIYADTFRGLGNSDVSINGVSLSREAQQLLCHFIGLKDTGSSPPSNI
INNGIDYDQAVILVSKSHVGEEQKALLTAVLCQPEFVAAICSSFYQSFTVPAFLLMHERI
FLARQHFSEKSLVLPNAHFSINISNSSNGGLYVFNNVGTFIMAPGERGDVVGVFTMRTSY
EIPLGTRCEIPELVRVIKPIYSASEAYSRN
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgataaatggcatttctcaactgaggtctattcagtcaaattcagctcagtcaaattca
gctttattcgctctggaatcggtattagacgtaagttcttacctggaaaataactggtct
gacaagccatgggctgagcgaattctaagctacttaggtttaagccattgtaggtcggag
tataaaggtgacgaccgattattattggatgtattaagtatattaaaaccgatattacca
agtagtaatgaagcaggaaaagtgcaggcaagtttttcggatggctccaggctaaccatt
tcagtcacaaaaagtgagctgattgaaatagctgttactaccccagaaggggatgaggtt
tccatatttcctgaaagaaataaacaagattgtttactgaaatcattacctgttgctttg
catatgccatatattaaaaaacatcattctttaccggaaattgaggtgaatggggctgat
ggcatgcgttttttatgtaattttgctgccaaactttcaacagcaatagttccttatagt
gaaaaaacgaatcccctttctggcgtaagccccctgaattctatatatgcagatacgttc
agagggcttggaaactcagacgtctctattaatggtgtaagtttatctcgtgaagctcag
caacttctttgtcattttattggtcttaaagatacaggctcttctcctccctcaaacatc
ataaataacggtattgattatgatcaggctgttatcttggtctctaaaagtcatgttgga
gaagaacaaaaggcccttttgactgcggtactgtgtcagcctgaatttgttgctgctata
tgttcctctttctatcaatcgtttactgttcctgcttttttgttaatgcatgagcgaata
tttctcgcgcgtcagcatttttcagaaaaatcattagttttaccaaatgcacattttagt
ataaatatatcgaattcttcaaatggtggactctatgtttttaacaatgtgggtaccttc
atcatggctccgggagagagaggtgatgttgtcggtgtatttactatgagaacatcttat
gaaatacctttgggtaccaggtgtgaaatacctgagctcgttcgagtgattaaacccatt
tacagtgcatctgaagcatattcgaggaattga

KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3970
Entry
E2348C_3970       CDS       T00796                                 
Symbol
espG
Name
(GenBank) LEE-encoded effector EspG
  KO
K12785  LEE-encoded effector EspG
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Module
ecg_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_3970 (espG)
SSDB
Motif
Pfam: EspG
Other DBs
NCBI-ProteinID: CAS11518
UniProt: B7UMC8
LinkDB
Position
4135193..4136389
AA seq 398 aa
MILVAKLFITNQIGESLMINGLNNDSASLVLDAAMKVNSGFKKSWDEMSCAEKLLKVLSF
GLWNPTYSRSERQSFQELLTVLEPVYPLPNELGRVSARFSDGSSLRISVTNSESIEAEIR
TPDNEKITVLLESNEQNRLLQSLPIDRHMPYIQVHRALSEMDLTDTTSMRNLLGFTSKLS
TTLIPHNAQTDPLSGPTPFSSIFMDTCRGLGNAKLSLNGVDIPANAQMLLRDALGLKDTH
SSPSRNVIDHGISRHDAEQIARESSGSDNQKAEVVEFLCHPEAATAICSAFYQSFNVPAL
TLTHERISKASEYNAERSLDTPNACINISISQSSDGNIYVTSHTGVLIMAPEDRPNEMGM
LTNRTSYEVPQGVKCTIDEMVRALQPRYAASETYLQNT
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgatacttgttgccaaattgttcattacaaaccagataggagaatctctcatgataaat
ggacttaataatgactccgcatctttagttttagatgctgcaatgaaagttaattctggg
tttaaaaaaagctgggatgagatgtcatgcgctgaaaagttacttaaagtacttagtttt
ggtttatggaatccaacgtacagtcgtagtgaaagacaatcatttcaagagttgttaacc
gttttagagcctgtatatccacttcccaatgaattaggcagagtatctgctcgtttttca
gatggctcatccttaagaatttccgtcactaacagcgaaagtattgaagccgagattcgc
acaccagataatgaaaagattactgtgctcctggagtcaaacgaacaaaataggttatta
caatctttacccatcgatcgccacatgccatacattcaggttcatcgtgccttatctgag
atggacctgactgatactacctcaatgcgcaatctacttggttttacgtcaaaactatca
acaaccttgattcctcataatgctcaaacagatccgctttccgggcctacaccattcagc
tctatctttatggatacatgtcgaggactcggcaatgcaaagctttcactcaatggtgtt
gatatacctgcaaatgcacaaatgttgcttcgcgatgcactaggacttaaagacacacac
tcatcaccttcccggaatgttatagatcatggtatttctcgccatgatgcagagcaaata
gcaagagaaagcagcggcagcgataatcagaaagctgaagttgtggaatttttatgccat
ccagaagcagcaacggccatatgctcggctttctatcaatctttcaatgtgccagcctta
acgttgacacatgaaaggatctctaaagccagtgaatacaatgcggaaagatcgttagat
acacctaacgcttgcattaacatcagtatctctcaatcatcagatggaaacatttatgtt
accagccataccggggttctgataatggcgccagaagaccgccccaacgagatgggcatg
ttgacgaacaggacttcttatgaagtgccgcaaggtgtgaaatgtacaatcgatgaaatg
gtaagagcgctacaaccaaggtatgccgcatctgaaacgtacttacaaaacacttaa

DBGET integrated database retrieval system