Escherichia coli APEC O78 (APEC): APECO78_08885 Help Entry APECO78_08885     CDS       T02445                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ecoa  Escherichia coli APEC O78 (APEC) Pathway ecoa00190   Oxidative phosphorylation ecoa01100   Metabolic pathways ecoa02020   Two-component system Module ecoa_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecoa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     APECO78_08885  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     APECO78_08885 Enzymes [BR:ecoa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      APECO78_08885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AGC86508 LinkDB All DBs Position 1827689..1827781 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system