Escherichia coli K-12 C3026: C3026_05975 Help Entry C3026_05975       CDS       T09611                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ecoc  Escherichia coli K-12 C3026 Pathway ecoc00190   Oxidative phosphorylation ecoc01100   Metabolic pathways ecoc02020   Two-component system Module ecoc_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ecoc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C3026_05975  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     C3026_05975 Enzymes [BR:ecoc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      C3026_05975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AMH34441 UniProt:  P24244 Structure PDBPDBj LinkDB All DBs Position 1159501..1159593 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system