KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0797
Entry
ECRM13516_0797    CDS       T03011                                 
Symbol
nleH
Name
(GenBank) T3SS secreted effector NleH
  KO
K16042  non-LEE-encoded effector NleH
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_0797 (nleH)
SSDB
Motif
Pfam: DUF6673 YrbL-PhoP_reg
Other DBs
NCBI-ProteinID: AHG13471
LinkDB
Position
826365..827246
AA seq 293 aa
MLSPSSVNLGCSWNSLTRNLTSPDSRILSSVRDAAASSDNGAQVKVGNRTYRVVVTDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNSSPVNRAMERGAVHSNRPDLPPVDYA
PPELPSVDYNSLPVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTNEVRCFNQY
YGAGSAEKIYGDNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFIDT
TETNVLYDRTRNEFNPIDISSYNISERSWSENQIMQSYHGGKQDLISVVLSKI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgctatcaccatcttctgtaaatttggggtgttcatggaattctttaaccagaaacctg
acttctcctgacagtcgtattttatcctctgtaagggatgcagctgctagctcggataat
ggggcgcaagtaaaggtgggcaacagaacatatcgtgttgttgtcactgataataagttt
tgcgttacaagagaaagtcatagtggttgctttactaatctgttgcacaggctgggatgg
cctaagggagagattagcaggaaaattgaggtgatgctgaattcatcgccagtgaatagg
gctatggaaagaggtgctgttcattcgaatagacctgatttacctcctgttgattatgca
ccgccagagttaccgagtgtggactataacagcttgcctgtgcctggtaatgttattggc
aaagggggtaacgctgtagtatatgaagatgctgaggatgcaacaaaagtcctgaagatg
tttactacatctcaaagcaatgaagaggtaacaaacgaagttcgttgcttcaaccaatat
tatggtgccgggagtgcagaaaaaatatatggcgataatggcgatattattggtattaga
atggataaaataaatggagaatcgcttttaaatatttcgtccttgccggcacaggctgag
catgccatttatgatatgtttgacaggcttgagcaaaaaggaattctttttatcgataca
acagagacaaatgtcttatatgatcgcacgagaaatgaatttaatccaatagatatatca
tcttataatatttctgaacgttcatggagtgaaaatcaaataatgcaatcttatcatgga
ggaaagcaagatcttattagtgtggtattaagtaaaatttag

KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2458
Entry
ECRM13516_2458    CDS       T03011                                 
Symbol
nleH_2
Name
(GenBank) T3SS secreted effector protein NleH
  KO
K16042  non-LEE-encoded effector NleH
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2458 (nleH_2)
SSDB
Motif
Pfam: DUF6673
Other DBs
NCBI-ProteinID: AHG15120
LinkDB
Position
complement(2418599..2419303)
AA seq 234 aa
MFYPSVRDAAAHSDNGAQVKVSNRTYRVVLSDNRFCVTRESHSGCFTNMLYRLGWPKGEI
TRKIEAMLNSSTVSTTIERGSVRSNRPDLPPVDYAQPELPPADYTQSALLRLSNNKSPVL
GNVIGKGGNAVVYEDMENTTKVLKMFTISQSHEEVTSEVRCFNQYYGAGSAEKIYGDNRD
IIGIRMDKINGESLLNISSLPAQAEHAIYDMFERLEKKEFFLLIQQKQMFYMIV
NT seq 705 nt   +upstreamnt  +downstreamnt
gtgttttatccctctgtaagggatgctgccgctcactctgataatggggcgcaagtaaag
gttagcaacagaacatatcgcgttgttttaagtgataataggttttgcgtgacaagagag
agtcatagtggatgttttactaatatgctgtatagactgggatggcctaagggagagatc
accagaaaaattgaggctatgctgaattcatcgacagtgagcacgactatagaaagagga
tctgttcgttcgaacagacctgatttacctccagtggattatgcgcagccggagttaccg
ccagcggattatactcagtcagcgttgctgaggcttagcaacaacaaatcacccgtgcta
ggtaacgttattggtaaaggtggtaatgctgtcgtgtatgaagatatggaaaatacaaca
aaagtgttgaagatgtttactatatctcaaagccatgaagaggtgacaagcgaagttcgt
tgtttcaaccagtattatggtgccgggagtgcagagaaaatatatggcgataatagagat
attattggtattagaatggataaaataaatggagaatcgcttttaaatatttcgtccttg
ccagcacaggctgagcatgctatttatgatatgtttgagagactggaaaaaaaggaattc
tttttgttgatacaacagaaacaaatgttttatatgatcgtgtga

DBGET integrated database retrieval system