KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0799
Entry
ECRM13516_0799    CDS       T03011                                 
Symbol
cif
Name
(GenBank) Cell Inhibiting Factor (Cif)
  KO
K23660  cell inhibiting factor
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_0799 (cif)
SSDB
Motif
Pfam: CIF
Other DBs
NCBI-ProteinID: AHG13473
LinkDB
Position
827470..828297
AA seq 275 aa
MKDITLPPPTSASCLTGAISVNTEAVLSPMQHTSALHVRDFASLCSQNLKANVLLNSDDH
EVPIHQKNPAAIMQNIDSNIKQMATDWGMSIEEVEVIIGREKGIVEPSCGVTANAIMKLF
LDKDGFSYCFENEQTLSLEQLQERLSCMPECKSFVLRVNDGALGHAYIVDIPKGENSCRP
AFLYQSDLGEGVTRKLRFEDWMTHKALTPILLDDICNYFSCMSQNKTDLEQIATLFDIDG
NVKMLRKENIQYQKHDNFSFQLFEYDTDNIEKTLR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaaagacattacccttccccccccgacgtccgcgtcctgtctgacaggggccatatct
gtaaatactgaagctgtattatctcccatgcaacacacttcagccttacatgtaagagat
tttgcttccctgtgctcacagaacctcaaagctaatgtattgctaaatagtgatgaccac
gaagtacctatacatcagaaaaatcctgctgcaataatgcaaaatatcgactctaacatc
aaacagatggcaacagactgggggatgtcgattgaggaggttgaggttattatagggcga
gagaaaggcattgtggaaccctcctgcggagttaccgctaatgctattatgaaactattt
ctggacaaggatggcttcagttactgctttgaaaatgaacagacactatcgctcgagcag
cttcaggagcgcctgtcctgtatgcctgaatgtaagagctttgtattacgtgttaatgat
ggtgcgcttggtcatgcttacattgtcgatattcccaaaggagaaaactcttgtcgtcct
gcattcttgtatcagtcagatttaggagagggcgtcaccagaaagttaagatttgaggac
tggatgacgcataaagcattgactccgattttgctggatgatatttgtaattacttctcc
tgcatgtctcaaaataagacagatttggagcagattgcaacgttatttgatattgatgga
aatgttaaaatgttacgaaaggaaaatattcaatatcaaaagcatgacaattttagtttc
cagttgtttgagtatgacaccgataatattgaaaaaacattgagataa

DBGET integrated database retrieval system