KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_1778
Entry
ECRM13516_1778    CDS       T03011                                 
Symbol
gapC
Name
(GenBank) NAD-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00010  Glycolysis / Gluconeogenesis
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01120  Microbial metabolism in diverse environments
ecoh01200  Carbon metabolism
ecoh01230  Biosynthesis of amino acids
ecoh05130  Pathogenic Escherichia coli infection
Module
ecoh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecoh_M00002  Glycolysis, core module involving three-carbon compounds
ecoh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECRM13516_1778 (gapC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_1778 (gapC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecoh04131]
    ECRM13516_1778 (gapC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoh04147]
    ECRM13516_1778 (gapC)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ECRM13516_1778 (gapC)
Membrane trafficking [BR:ecoh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECRM13516_1778 (gapC)
Exosome [BR:ecoh04147]
 Exosomal proteins
  Proteins found in most exosomes
   ECRM13516_1778 (gapC)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C NAD_binding_3 TrkA_N
Other DBs
NCBI-ProteinID: AHG14445
LinkDB
Position
complement(1765140..1766141)
AA seq 333 aa
MSKVGINGFGRIGRLVLRRLLEVKSNIDVVAINDLTSPKILAYLLKHDSNYGPFPWSVDF
TEDSLIVNGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLIS
APAGEMKTIVYNVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYT
GTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSV
TELVSILGKKVTAEEVNNALKQATTNNESFGYTDEEIVSSDIIGSHFGSVFDATQTEITA
VGDLQLVKTVAWYDNEYGFVTQLIRTLEKFAKL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagtaaagttggtattaacggttttggtcgtatcggtcgactggtgttgcgtcgatta
cttgaagtcaaaagcaacatagacgttgtcgctattaatgatctcacttctccaaaaatt
ctcgcctacctgctgaaacatgattcaaactacggaccgttcccctggagcgttgatttt
acggaagattcacttatcgttaatgggaaaagtatcgcggtttacgccgaaaaagaggct
aaaaatattccgtggaaagcgaaaggtgcagaaatcattgtcgaatgtactggcttttat
acctccgccgagaaatcgcaggcgcatcttgatgctggtgcgaagaaggtgttgatttcc
gctcctgccggtgaaatgaaaaccatcgtttataacgttaatgacgacactctggatggc
aacgacaccattgtttccgtggcgtcatgcaccactaactgccttgcgccgatggccaaa
gccttgcatgacagtttcgggatagaagtcggcacgatgacgaccattcatgcctatact
ggcacccagtcactggtggatggcccgcgtggtaaagatttacgtgcttcacgcgcagcg
gcagaaaatatcattccccacactacgggcgcggcaaaagccattggtctggtgatcccg
gaactgagcggcaaactgaaaggtcatgcgcaacgcgtgccggtgaaaacaggttcggtc
actgaactggtatcgattctcggaaaaaaagtgactgccgaagaggtgaataacgcactt
aaacaagcaaccaccaataacgagtcatttggttataccgatgaagaaatagtctcttcc
gatatcattggcagccatttcggttcggtgtttgatgccacgcaaacggaaattaccgcc
gtgggcgatttacaactggtgaaaacggtcgcctggtacgataacgaatatggcttcgtc
acgcagcttattcgcaccctcgaaaaattcgctaaactctga

KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2183
Entry
ECRM13516_2183    CDS       T03011                                 
Symbol
gapA
Name
(GenBank) NAD-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00010  Glycolysis / Gluconeogenesis
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01120  Microbial metabolism in diverse environments
ecoh01200  Carbon metabolism
ecoh01230  Biosynthesis of amino acids
ecoh05130  Pathogenic Escherichia coli infection
Module
ecoh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecoh_M00002  Glycolysis, core module involving three-carbon compounds
ecoh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECRM13516_2183 (gapA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2183 (gapA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecoh04131]
    ECRM13516_2183 (gapA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecoh04147]
    ECRM13516_2183 (gapA)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     ECRM13516_2183 (gapA)
Membrane trafficking [BR:ecoh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECRM13516_2183 (gapA)
Exosome [BR:ecoh04147]
 Exosomal proteins
  Proteins found in most exosomes
   ECRM13516_2183 (gapA)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AHG14849
LinkDB
Position
2174863..2175858
AA seq 331 aa
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMT
GPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactatcaaagtaggtatcaacggttttggccgtatcggtcgcattgttttccgtgct
gctcagaaacgttctgacatcgagatcgttgcaatcaacgacctgttagacgctgattac
atggcatacatgctgaaatatgactccactcacggccgtttcgacggtaccgttgaagtg
aaagacggtcatctgatcgttaacggtaaaaaaatccgtgttaccgctgaacgtgatccg
gctaacctgaaatgggacgaagttggtgttgacgttgtcgctgaagcaactggtctgttc
ctgactgacgaaactgctcgtaaacacatcaccgctggtgcgaagaaagtggttatgact
ggtccgtctaaagacaacactccgatgttcgttaaaggcgctaacttcgacaaatatgct
ggccaggacatcgtttccaacgcttcctgcaccaccaactgcctggctccgctggctaaa
gttatcaacgataacttcggcatcatcgaaggtctgatgaccaccgttcacgctactacc
gctactcagaaaaccgttgatggcccgtctcacaaagactggcgcggcggccgcggcgct
tcccagaacatcatcccgtcctctaccggtgctgctaaagctgtaggtaaagtactgcca
gaactgaatggcaaactgactggtatggcgttccgcgttccgaccccgaacgtatccgta
gttgacctgaccgttcgtctggaaaaagctgcaacttacgagcagatcaaagctgctgtt
aaagctgctgctgaaggcgaaatgaaaggcgttctgggctacaccgaagatgacgtagta
tctaccgatttcaacggcgaagtttgcacttccgtgttcgatgctaaagctggtatcgct
ctgaacgacaacttcgtgaaactggtatcctggtacgacaacgaaaccggttactccaac
aaagttctggacctgatcgctcacatctccaaataa

DBGET integrated database retrieval system