KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_1911
Entry
ECRM13516_1911    CDS       T03011                                 
Symbol
nleC
Name
(GenBank) T3SS secreted effector protein NleC
  KO
K23655  T3SS secreted effector NleC
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_1911 (nleC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecoh01002]
    ECRM13516_1911 (nleC)
Peptidases and inhibitors [BR:ecoh01002]
 Metallo peptidases
  Family M85
   ECRM13516_1911 (nleC)
SSDB
Motif
Pfam: Peptidase_M85
Other DBs
NCBI-ProteinID: AHG14579
LinkDB
Position
complement(1916073..1917059)
AA seq 328 aa
MKIPVLQPGFNFFAPAGYSAAVAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAV
HDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEEVHIGCIKYRNEYELNGES
AIKIDDIQSLTCNELYGYDVGQEPILPICEAGENENEEPYVSFSVAPDTDSYEMPSWQEG
LIHEIIHHVTGASDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN
LNALRQAAMRHEKNERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGVAID
ENLQDVNQIQLYHGAPYIFTFGDVDRHN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaaaattcccgttctccaacctggcttcaacttttttgcccctgctggatactctgct
gccgttgctcctaatcgtgctgaaaatgcctatgcggattacgttttggatataggtaag
cgaataccgctttccgcagcagatttaagcaacgtatacgaaagtgtaattcgcgccgtc
catgacagccgtagcaggctcatcgatcagcatacggtcgatatgattggcaacactgta
cttgatgcgttgagccgatcacaaacatttcgtgatgccgtaagctatggcattcataat
gaggaggtacacattggttgcattaaatacagaaacgaatacgagcttaacggagaatct
gctatcaaaattgatgatattcaatcactaacctgtaacgaattatatggatacgatgtc
gggcaagaaccaattctccccatttgcgaggcaggagaaaacgagaacgaagagccttat
gtcagttttagtgttgcgccagatactgattcttatgagatgccatcgtggcaggaagga
ctgattcacgagattattcatcatgttactggggccagcgatccatctggagatagtaat
atagagctaggacccaccgagattctcgcacgtcgtgtcgctcaagagctgggatggagt
gttcccgacttcaaaggatatgcagagccagaacgagaagctcatcttagactacgtaac
ctgaatgcccttcgacaggctgccatgaggcatgaaaagaatgagagggctttcttcgaa
agactgggtacgatcagtgaccgatatgaggcgagtcctgatttcacagagtattccgct
gtgtctaacataggatacggatttatccagcaacatgattttccaggggtggctatcgac
gagaatttacaggatgtaaatcagatccaactgtatcatggtgctccttatatctttaca
tttggggatgtggacagacacaattag

KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2281
Entry
ECRM13516_2281    CDS       T03011                                 
Symbol
nleC_2
Name
(GenBank) T3SS secreted effector protein NleC
  KO
K23655  T3SS secreted effector NleC
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2281 (nleC_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecoh01002]
    ECRM13516_2281 (nleC_2)
Peptidases and inhibitors [BR:ecoh01002]
 Metallo peptidases
  Family M85
   ECRM13516_2281 (nleC_2)
SSDB
Motif
Pfam: Peptidase_M85
Other DBs
NCBI-ProteinID: AHG14949
LinkDB
Position
complement(2264755..2265741)
AA seq 328 aa
MKIPVLQPGFNFFAPAGYSAAVAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVISAV
HDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEEVHIGCIKYRNEYELNGES
AIKIDDIQSLTCNELYGYDVGQEPILPICEAGENENEEPYVSFSVAPDTDSYEMPSWQEG
LIHEIIHHVTGASDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYADPEREAHLRLRN
LNALRQAAMRHEKNERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGGAID
ENLQDVNQIQLYHGAPYIFTFGDVDRHN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaaaattcccgttctccaacctggcttcaacttttttgcccctgctggatactctgct
gccgttgctcctaatcgtgctgaaaatgcctatgcggattacgttttggatataggcaag
cgaataccgctttccgcagcagatttaagcaacgtatacgaaagtgtaattagcgccgtc
catgacagccgtagcaggctcatcgatcagcatacggtcgatatgattggcaacactgta
cttgatgcgttgagccgatcacaaacatttcgtgatgccgtaagctatggcattcataat
gaggaggtacacattggttgcattaaatacagaaacgaatacgagcttaacggagaatct
gctatcaaaattgatgatattcaatcactaacctgtaacgaattatatggatacgatgtc
gggcaagaaccaattctccccatttgcgaggcaggagaaaacgagaacgaagagccttat
gtcagttttagtgttgcgccagatactgattcttatgagatgccatcgtggcaggaagga
ctgattcacgagattattcatcatgttactggggccagcgatccatctggagatagtaat
atagagctaggacccaccgagattctcgcacgtcgtgtcgctcaagagctgggatggagt
gttcccgacttcaaaggatatgcagatccagaacgagaagctcatcttagactacgtaac
ctgaatgcccttcgacaggctgccatgaggcatgaaaagaatgagagggctttcttcgaa
agactgggtacgatcagtgaccgatatgaggcgagtcctgatttcacagagtattccgct
gtgtctaacataggatacggatttatccagcaacatgattttccagggggggctatcgac
gagaatttacaggatgtaaatcagatccaactgtatcatggtgctccttatatctttaca
tttggggatgtggacagacacaattag

DBGET integrated database retrieval system