KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_2459
Entry
ECRM13516_2459    CDS       T03011                                 
Symbol
nleB_2
Name
(GenBank) T3SS secreted effector protein NleB
  KO
K23657  T3SS secreted effector NleB
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_2459 (nleB_2)
SSDB
Other DBs
NCBI-ProteinID: AHG15121
LinkDB
Position
complement(2420021..2421001)
AA seq 326 aa
MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVP
IVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVD
FSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHA
WFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHV
DRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNY
NHFCDFIEFNHPNIIMNTSQYTCSSW
NT seq 981 nt   +upstreamnt  +downstreamnt
atgctttcaccgataaggacaactttccataactcagtaaatatagtgcagagttcaccc
tgtcaaacggtttcttttgcaggaaaggaatatgagttaaaggtcattgatgaaaaaacg
cctattctttttcagtggtttgaacctaatcctgaacgatataagaaagatgaggttcca
atagttaatactaagcagcatccctatttagataatgtcacaaatgcggcaaggatagag
agtgatcgtatgataggtatttttgttgatggcgatttttcagtcaaccaaaagactgct
ttttcaaaattggaacgagattttgaaaatgtaatgataatctatcgggaagatgttgac
ttcagtatgtatgacagaaaactatcagatatttatcatgatattatatgtgaacaaagg
ttacgaactgaagacaaaagagatgaatacttgttgaatctgttagagaaagagctgagg
gaaatttcaaaggcgcaggattctttgatttctatgtatgcaaagaaaagaaatcatgca
tggtttgatttcttcagaaatttagccttattaaaagcaggagagatattcaggtgcaca
tataatacaaagaatcacggtatttcattcggggaggggtgtatctatcttgatatggat
atgatacttacaggtaagcttggtacaatatatgctcctgatggaatttcaatgcatgtg
gatcgtcgtaatgatagtgtaaatattgaaaatagtgcaataattgttaaccgtagtaat
catcctgctctacttgagggactttcttttatgcatagtaaagtagatgctcatccatat
tatgatggtttggggaaaggagttaagaaatattttaattttacaccattacataattat
aatcatttttgtgactttattgagtttaaccaccctaatataatcatgaacacaagtcag
tatacatgcagttcatggtaa

KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_5227
Entry
ECRM13516_5227    CDS       T03011                                 
Symbol
nleB_3
Name
(GenBank) T3SS secreted effector protein NleB
  KO
K23657  T3SS secreted effector NleB
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_5227 (nleB_3)
SSDB
Other DBs
NCBI-ProteinID: AHG17808
LinkDB
Position
5201652..5202641
AA seq 329 aa
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYPLEPIDEKTPILFQWFEARPERYEKG
EVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLSLENEYQNIKIIYRA
DVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKR
EHTWFDFFRNLAMLKAGTLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIA
VHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSL
HDYNAFCDFIEFKHENIIPNTSMYTSSSW
NT seq 990 nt   +upstreamnt  +downstreamnt
atgttatcttcattaaatgtccttcaatccagcttcagaggaaagacagccttatcaaat
agtacacttctccagaaagtttcttttgctggaaaagaatatcctctggaacctattgat
gaaaaaacccctattctttttcagtggtttgaagcaaggccagagcgatacgaaaaagga
gaagtaccaatattgaataccaaagaacatccgtatttgagcaatattataaatgctgca
aaaatagaaaatgagcgtataatcggtgtgctggtagatggaaattttacttatgaacaa
aaaaaggaatttctcagtcttgaaaatgaatatcaaaatataaaaataatctaccgagca
gatgtggatttcagcatgtatgataaaaaactatctgatatttaccttgaaaatatccat
aaacaagaatcataccctgccagtgagagggataattatctgttaggcttattaagagaa
gagttaaaaaatatcccagaaggtaaggactctttgattgagtcatatgcagaaaaaaga
gaacatacttggtttgattttttcaggaatttggccatgttgaaggctggaactttgttt
acagagacgggaaaaactggatgccataacatatcgccctgtagcggatgtatatatctt
gatgccgacatgattattaccgataaattaggagtcctgtatgctcctgatggtatcgct
gtgcatgtagattgtaatgatgagataaaaagtcttgaaaatggtgcgatagttgtcaat
cgtagtaatcatccagcattacttgcaggcctcgatattatgaagagtaaagttgacgct
catccatattatgatggtctaggaaagggtatcaagcggcattttaactattcatcgtta
cacgattataatgctttttgtgattttattgaatttaagcatgaaaatattataccgaat
accagtatgtataccagcagttcatggtaa

DBGET integrated database retrieval system