KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4469
Entry
ECRM13516_4469    CDS       T03011                                 
Symbol
ssaG
Name
(GenBank) Type III secretion protein SsaG
  KO
K03221  type III secretion protein F
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh03070  Bacterial secretion system
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECRM13516_4469 (ssaG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4469 (ssaG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecoh02044]
    ECRM13516_4469 (ssaG)
Secretion system [BR:ecoh02044]
 Type III secretion system
  Type III secretion core apparatus
   ECRM13516_4469 (ssaG)
SSDB
Motif
Pfam: T3SS_needle_F Spectrin
Other DBs
NCBI-ProteinID: AHG17084
LinkDB
Position
complement(4424428..4424649)
AA seq 73 aa
MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKT
IKDLVSTISNRSF
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaatttatctgaaattactcaacaaatgggtgaagtaggtaaaacgctgagcgattct
gtgccagagttacttaatagcaccgatttggttaatgaccctgaaaaaatgttagagttg
cagtttgcggttcagcaatattctgcttatgttaacgtagaaagtggaatgttgaaaacg
ataaaagatctggtctcaaccatttctaaccgtagtttttaa

DBGET integrated database retrieval system