KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4471
Entry
ECRM13516_4471    CDS       T03011                                 
Symbol
espB
Name
(GenBank) T3SS secreted effector protein EspB
  KO
K23650  LEE-encoded effector EspB
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4471 (espB)
SSDB
Motif
Pfam: EspB DUF4064 CATRA-C
Other DBs
NCBI-ProteinID: AHG17086
LinkDB
Position
complement(4425099..4426037)
AA seq 312 aa
MNTIDNTQVTMVNSASESTTGASSAVAASALSIDSSLLTDGKVDICKLMLEIQKLLGKMV
TLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGIISSALGILGSFAAMNN
AAKGAGEIAEKASSASSKAAGAASEVANKALVKATESVADVAEEASSAMQKAMATTTKAA
SRASGVADDVAKASDFAEDLADAAEKTSRINKLLNSVDKLTNTTAFVAVTSLAEGTKTLP
TTISESVKSTHEVNEQRAKSLENFQQGNLELYKQDVRRTQDDITTRLRDITSAVRDLLEV
QNRMGQSGRLAG
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaatactattgataatactcaagtaacgatggttaattccgcttcggagagtacgacc
ggcgcttccagtgcagttgccgcatctgctttatcaattgattcatctctgcttactgat
ggtaaggttgatatttgtaagctgatgctggaaattcaaaaactcctcggcaagatggtg
actctattgcaggattaccaacaaaaacaattggcgcaaagctatcagattcagcaggcc
gtttttgagagccagaataaagctattgaggaaaaaaaagccgcggcaaccgctgctttg
gttggcgggattatttcatcagcattggggatcttaggttcttttgcagcaatgaacaac
gcggctaaaggggctggtgagattgctgaaaaagcaagctctgcatcttcaaaggctgct
ggtgcggcttctgaggttgcaaataaagctctggtcaaggctacggaaagtgttgctgat
gtcgcagaggaggcatccagtgcgatgcagaaagcgatggccacaacaacgaaagcagcc
agccgtgcatctggcgttgcagatgatgttgcgaaagcctctgactttgctgaagatctt
gcagacgccgccgagaagacaagcagaatcaataagttgttgaattccgtagataaactg
accaataccacagcatttgttgccgtgaccagtcttgctgaaggtacgaaaacgttgcca
acaacaatatctgagtccgtcaaatcgactcatgaggttaatgaacaacgtgcgaagtcg
ctggaaaacttccagcaggggaatctggagctgtataaacaagacgttcgcagaacgcag
gatgatatcacgactcgtctgcgtgatataacatccgctgtccgcgatctccttgaggtc
cagaatcgtatggggcaatcgggtcgcttagctgggtaa

DBGET integrated database retrieval system