KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4479
Entry
ECRM13516_4479    CDS       T03011                                 

Symbol
map_2
Name
(GenBank) T3SS secreted effector protein Map
  KO
K12787  LEE-encoded effector Map
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_4479 (map_2)
SSDB
Motif
Pfam: IpaB_EvcA
Other DBs
NCBI-ProteinID: AHG17094
LinkDB
Structure
PDB: 
3GCG

Position
complement(4436089..4436700)
AA seq 203 aa
MFSPMTMAGRSLVQATAQTLRPAVTRAAMQAGTGATGMRFMPVQSNFVINHGKLTNQLLQ
AVAKQTRNGDTQQWFQQEQTTYISRTVNRTLDDYCRSNNSVISKETKGHIFRAVENALQQ
PLDMNGAQSSIGHFLQSNKYFNQKVDEQCGKRVDPITRFNTQTKMIEQVSQEIFERNFSG
FKVSEIKAITQNAILEHVQDTRL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtttagtccaatgacaatggcaggcagatcgttagttcaggcgactgcacagacgctt
agacctgcggttaccagagctgcaatgcaagcgggtacgggagccacgggtatgaggttc
atgcccgtgcagtcgaactttgtgattaatcatggcaaactgactaaccaactcctgcag
gctgtagccaaacaaactcgtaatggcgatacccaacaatggttccagcaggagcagacg
acttatatatccagaacagtaaatagaactctggatgactattgcaggagtaataattcg
gtcattagtaaggagactaaaggtcacatttttagagctgttgaaaatgcgttacagcaa
cctcttgatatgaacggggcacaatcatcaattggtcacttcttgcagtccaataaatac
tttaatcagaaagttgatgagcagtgcggcaaaagagtggatccaataacacgttttaac
acccagacgaagatgatagaacaagtctcacaagaaatatttgaacgcaactttagcggc
ttcaaagtcagtgagataaaagcgattactcagaatgcgattttagagcatgtacaggat
acccgattgtag

DBGET integrated database retrieval system