KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_5228
Entry
ECRM13516_5228    CDS       T03011                                 
Symbol
nleE
Name
(GenBank) T3SS secreted effector protein NleE
  KO
K23654  T3SS secreted effector NleE
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECRM13516_5228 (nleE)
SSDB
Motif
Pfam: Arm-DNA-bind_2
Other DBs
NCBI-ProteinID: AHG17809
LinkDB
Position
5202690..5203364
AA seq 224 aa
MINPVTNTQGVSPINTKYAEHVVKNIYPEIKHDYFNESPNIYDKKYISGITRGVAELKQE
EFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNP
DLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgattaatcctgttactaatactcagggcgtgtcccctataaatactaaatatgctgaa
catgtggtgaaaaatatttacccggaaattaaacatgattactttaatgaatcacccaat
atatatgataagaagtatatatccggtataaccagaggagtagctgaactaaaacaggaa
gaatttgttaacgagaaagccagacggttttcttatatgaagactatgtattctgtatgt
ccagaagcgtttgaacctatttccagaaatgaagccagtacaccggaaggaagctggcta
acagttatatccggaaaacgcccaatggggcagttttctgtagatagtttatacaatcct
gatttacatgcattatgtgagcttccggacatttgttgtaagatcttccctaaagaaaat
aatgattttttatacatagttgttgtgtacagaaatgacagccctctaggagaacaacgg
gcaaatagatttatagaattatataatataaaaagagatatcatgcaggaattaaattat
gagttaccagagttaaaggcagtaaaatctgaaatgattatcgcacgtgaaatgggagaa
atctttagctacatgcctggggaaatagacagttatatgaaatacataaataataaactt
tctaaaattgagtag

DBGET integrated database retrieval system