Etheostoma cragini (Arkansas darter): 117942763 Help Entry 117942763         CDS       T07493                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ecra  Etheostoma cragini (Arkansas darter) Pathway ecra04137   Mitophagy - animal ecra04140   Autophagy - animal ecra04144   Endocytosis ecra04145   Phagosome ecra04148   Efferocytosis ecra05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecra00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117942763 (rab7a)    04145 Phagosome     117942763 (rab7a)    04140 Autophagy - animal     117942763 (rab7a)    04137 Mitophagy - animal     117942763 (rab7a)    04148 Efferocytosis     117942763 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117942763 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecra04131]     117942763 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecra04147]     117942763 (rab7a)    04031 GTP-binding proteins [BR:ecra04031]     117942763 (rab7a) Membrane trafficking [BR:ecra04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     117942763 (rab7a) Exosome [BR:ecra04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117942763 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    117942763 (rab7a)   Exosomal proteins of colorectal cancer cells    117942763 (rab7a)   Exosomal proteins of bladder cancer cells    117942763 (rab7a) GTP-binding proteins [BR:ecra04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     117942763 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_24 AAA_22 AAA_16 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ATP-synt_ab Motif Other DBs NCBI-GeneID:  117942763 NCBI-ProteinID:  XP_034724299 LinkDB All DBs Position 4:complement(6886915..6891927) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtactactcaaagtcatcatcctcggagactctggagttggg aagacctcgttgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagctaca ataggagcggatttcctgacgaaagaagtcatggtggatgacagactggtcacaatgcag atttgggacacagcaggtcaggagaggttccagtccttaggtgtagcgttctaccgtgga gcagactgctgcgtcctggtgtttgatgtgaccgcacccaacaccttcaagactctagac agctggagagacgagttcttgatccaggccagccctcgagacccggagaatttccccttt gttgtgctgggcaataagatcgacctggagaacagacaggtaacaaccaagcgagcacag gcttggtgtcaaagtaagaacaacatcccatatttcgaaaccagtgccaaggaggcaatc aatgtggagcaggccttccagactattgcacgcaacgccctcaaacaggagaccgaagtg gagttgtacaacgagttccctgagccaataaagctggacaggaacgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system