KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_0846
Entry
ECs_0846          CDS       T00048                                 
Symbol
nleB2-1
Name
(RefSeq) T3SS secreted effector NleB
  KO
K23657  T3SS secreted effector NleB
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_0846 (nleB2-1)
SSDB
Motif
Pfam: SidC_lipid-bd
Other DBs
NCBI-GeneID: 917585
NCBI-ProteinID: NP_308873
UniProt: Q8X837
LinkDB
Position
924622..925602
AA seq 326 aa
MLSPIRTTFHNSVNIVQSSPCQTVSFAGKEYELKVIDEKTPILFQWFEPNPERYKKDEVP
IVNTKQHPYLDNVTNAARIESDRMIGIFVDGDFSVNQKTAFSKLERDFENVMIIYREDVD
FSMYDRKLSDIYHDIICEQRLRTEDKRDEYLLNLLEKELREISKAQDSLISMYAKKRNHA
WFDFFRNLALLKAGEIFRCTYNTKNHGISFGEGCIYLDMDMILTGKLGTIYAPDGISMHV
DRRNDSVNIENSAIIVNRSNHPALLEGLSFMHSKVDAHPYYDGLGKGVKKYFNFTPLHNY
NHFCDFIEFNHPNIIMNTSQYTCSSW
NT seq 981 nt   +upstreamnt  +downstreamnt
atgctttcaccgataaggacaactttccataactcagtaaatatagtgcagagttcaccc
tgtcaaacggtttcttttgcaggaaaggaatatgagttaaaggtcattgatgaaaaaacg
cctattctttttcagtggtttgaacctaatcctgaacgatataagaaagatgaggttcca
atagttaatactaagcagcatccctatttagataatgtcacaaatgcggcaaggatagag
agtgatcgtatgataggtatttttgttgatggcgatttttcagtcaaccaaaagactgct
ttttcaaaattggaacgagattttgaaaatgtaatgataatctatcgggaagatgttgac
ttcagtatgtatgacagaaaactatcagatatttatcatgatattatatgtgaacaaagg
ttacgaactgaagacaaaagagatgaatacttgttgaatctgttagagaaagagctgagg
gaaatttcaaaggcgcaggattctttgatttctatgtatgcaaagaaaagaaatcatgca
tggtttgatttcttcagaaatttagccttattaaaagcaggagagatattcaggtgcaca
tataatacaaagaatcacggtatttcattcggggaggggtgtatctatcttgatatggat
atgatacttacaggtaagcttggtacaatatatgctcctgatggaatttcaatgcatgtg
gatcgtcgtaatgatagtgtaaatattgaaaatagtgcaataattgttaaccgtagtaat
catcctgctctacttgagggactttcttttatgcatagtaaagtagatgctcatccatat
tatgatggtttggggaaaggagttaagaaatattttaattttacaccattacataattat
aatcatttttgtgactttattgagtttaaccaccctaatataatcatgaacacaagtcag
tatacatgcagttcatggtaa

KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_3857
Entry
ECs_3857          CDS       T00048                                 
Symbol
nleB1
Name
(RefSeq) T3SS secreted effector NleB
  KO
K23657  T3SS secreted effector NleB
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_3857 (nleB1)
SSDB
Motif
Pfam: SidC_lipid-bd SipA_2nd
Other DBs
NCBI-GeneID: 916317
NCBI-ProteinID: NP_311884
UniProt: Q8XBX8
LinkDB
Position
3863741..3864730
AA seq 329 aa
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYPLEPIDEKTPILFQWFEARPERYEKG
EVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLSLENEYQNIKIIYRA
DVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKR
EHTWFDFFRNLAMLKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIA
VHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSL
HDYNAFCDFIEFKHENIIPNTSMYTCSSW
NT seq 990 nt   +upstreamnt  +downstreamnt
atgttatcttcattaaatgtccttcaatccagcttcagaggaaagacagctttatcaaat
agtacacttctccagaaagtttcttttgctggaaaagaatatcctctggaacctattgat
gaaaaaacccctattctttttcagtggtttgaagcaaggccagagcgatacgaaaaagga
gaagtaccaatattgaataccaaagaacatccgtatttgagcaatattataaatgctgca
aaaatagaaaatgagcgtataatcggtgtgctggtagatggaaattttacttatgaacaa
aaaaaggaatttctcagtcttgaaaatgaatatcaaaatataaaaataatctaccgagca
gatgtggatttcagcatgtatgataaaaaactatctgatatttaccttgaaaatatccat
aaacaagaatcataccctgccagtgagagggataattatctgttaggcttattaagagaa
gagttaaaaaatatcccagaaggtaaggactctttgattgagtcatatgcagaaaaaaga
gaacatacttggtttgattttttcaggaatttggccatgttgaaggctggaagtttgttt
acagagacgggaaaaactggatgccataacatatcgccctgtagcggatgtatatatctt
gatgccgacatgattattaccgataaattaggagtcctgtatgctcctgatggtatcgct
gtgcatgtagattgtaatgatgagataaaaagtcttgaaaatggtgcgatagttgtcaat
cgtagtaatcatccagcattacttgcaggcctcgatattatgaagagtaaagttgacgct
catccatattatgatggtctaggaaagggtatcaagcggcattttaactattcatcgtta
cacgattataatgctttttgtgattttattgaatttaagcatgaaaatattataccgaat
accagtatgtatacctgcagttcatggtaa

DBGET integrated database retrieval system