KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_0847
Entry
ECs_0847          CDS       T00048                                 
Symbol
nleC
Name
(RefSeq) T3SS secreted effector NleC
  KO
K23655  T3SS secreted effector NleC
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_0847 (nleC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecs01002]
    ECs_0847 (nleC)
Peptidases and inhibitors [BR:ecs01002]
 Metallo peptidases
  Family M85
   ECs_0847 (nleC)
SSDB
Motif
Pfam: Peptidase_M85
Other DBs
NCBI-GeneID: 917594
NCBI-ProteinID: NP_308874
UniProt: Q8X834
Structure
LinkDB
Position
925636..926655
AA seq 339 aa
MICRVLDINMKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSN
VYESVIRAVHDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEKVHIGCIKYR
NEYELNEESSVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPYVSFSVAPDTDS
YEMPSWQEGLIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPE
REAHLRLRNLNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQ
HDFPGLAINDNLQDANQIQLYHGAPYIFTFGDVDKHNQQ
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgatttgcagggtattagatataaacatgaaaattccctcattacagtccaacttcaac
ttttccgccccggcaggatactctgctcccattgctcctaatcgtgctgaaaatgcctat
gcggattacgttttggatataggtaagcgaataccactttccgcagcagatttaagcaac
gtatacgaaagtgtaatacgcgccgtccatgacagccgtagcaggcttatcgatcagcat
acagtcgatatgatcggcaacactgtacttgatgctttgagccgatcacagacatttcgt
gatgccgtaagctatggcattcataatgagaaggtacacattggttgcattaaatacaga
aacgaatacgagcttaacgaagaatcttctgtcaaaattgatgatattcaatcactaacc
tgtaacgaattatatgaatatgatgtcgggcaagagccaattttccccatttgcgaagca
ggagaaaacgataacgaagagccttatgtcagttttagtgttgcgccagatactgactct
tatgagatgccatcgtggcaggaaggactgattcacgagattattcatcatgttactgga
tctagcgatccatctggagatagtaatatagagttaggacccaccgagattctcgcacgt
cgtgtcgctcaagaactgggatggagtgttcccgacttcaaaggatatgcagagccagaa
cgtgaagctcatcttaggctacgtaacctgaatgcccttcgacaggctgccatgaggcat
gaagagaatgagagggctttcttcgaaaggctgggtacgatcagtgaccgatatgaggcg
agtcctgatttcacagagtattccgctgtgtctaacataggatacggatttatccagcaa
catgattttcctggattggctatcaacgataatttacaggatgcaaatcagatccaactg
tatcatggcgccccttatatttttacatttggggatgtggacaaacacaatcagcaatga

DBGET integrated database retrieval system