KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_0848
Entry
ECs_0848          CDS       T00048                                 
Symbol
nleH1-1
Name
(RefSeq) T3SS secreted effector NleH
  KO
K16042  non-LEE-encoded effector NleH
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Module
ecs_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_0848 (nleH1-1)
SSDB
Motif
Pfam: OspG_kinase DUF6673
Other DBs
NCBI-GeneID: 917591
NCBI-ProteinID: NP_308875
UniProt: Q8X831
Structure
LinkDB
Position
927483..928364
AA seq 293 aa
MLSPYSVNLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDNGAQVKVGNRTYRVVATDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNASPVSAAMERGIVHSNRPDLPPVDYA
PPELPSVDYNRLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQY
YGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDT
TETNVLYDRAKNEFNPIDISSYNVSDRSWSESQIMQSYHGGKQDLISVVLSKI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgttatcgccatattctgtaaatttgggatgttcatggaattctttaaccagaaacctg
acttcgcctgataatcgtgttttatcctctgtaagggatgctgccgttcattctgataat
ggggcgcaagtaaaggttggcaacagaacatatcgtgttgttgccaccgataataagttt
tgcgttacaagagaaagtcatagtggttgttttactaatctgttgcacaggctgggatgg
cctaagggggagattagcaggaaaattgaggtcatgctgaatgcatcaccagtgagcgct
gctatggaaagaggcattgttcattcgaacagacctgatttacctcctgttgattatgca
ccgccagagttaccgagtgtggactataacaggttgtcagtacctggtaatgttattggc
aaaggggggaacgctgtagtatatgaagatgctgaggatgcaacaaaagtcctgaagatg
tttactacatctcaaagcaatgaagaggtgacaagcgaagttcgttgcttcaaccaatat
tatggtgccgggagtgcagaaaaaatatatggcaataatggtgatattattggtattaga
atggataaaataaatggagaatcgcttttaaatatttcgtccttgccagcacaggctgag
catgctatttacgatatgtttgatagactggagcaaaaaggaattctttttgtcgataca
acagagacaaatgtcttatatgaccgcgcgaagaatgagtttaatccaatagatatatca
tcttataatgtttccgaccgttcatggagtgaaagtcaaataatgcaatcttatcatggc
ggaaagcaagatcttattagtgtggtattaagtaaaatttag

KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_1814
Entry
ECs_1814          CDS       T00048                                 
Symbol
nleH1_2
Name
(RefSeq) T3SS secreted effector NleH
  KO
K16042  non-LEE-encoded effector NleH
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Module
ecs_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_1814 (nleH1_2)
SSDB
Motif
Pfam: OspG_kinase DUF6673
Other DBs
NCBI-GeneID: 912906
NCBI-ProteinID: NP_309841
UniProt: Q8XAL6
Structure
LinkDB
Position
1804830..1805741
AA seq 303 aa
MLSPSSINLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDSGTQVTVGNRTYRVVVTDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEAMLNTSPVSTTIERGSVHSNRPDLPPVDYA
QPELPPADYTQSELPRVSNNKSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEV
TSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRL
EKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVL
SKI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgttatcgccctcttctataaatttgggatgttcatggaattctttaaccagaaacctg
acttcgcctgataatcgtgttttatcctctgtaagggatgctgctgttcactctgatagc
gggacgcaagtaacggttggcaacagaacatatcgtgttgtggtcactgataataagttt
tgcgttacaagagaaagtcatagtggttgttttactaatctgttgcacaggttgggatgg
cctaagggagagattagcagaaaaattgaggctatgctgaatacatcgccagtgagcacg
actatagaaagaggctctgttcattcgaacagacctgatttacctccagtggattatgcg
cagccggagttacctccagcggattatactcaatcagagttgccgagggttagcaacaat
aaatcacccgtgccaggtaatgttattggtaaaggtggtaatgctgtcgtgtatgaagat
atggaagatacaacaaaagtgttgaagatgtttactatatctcaaagccatgaagaggtg
acaagcgaagttcgttgtttcaatcagtattatggttccgggagtgcagagaaaatatat
aatgataatggaaatgttattggtattagaatgaataaaataaatggggaatctcttttg
gatattccatcattaccagcacaagctgaacaggctatttacgatatgtttgacagactg
gagaaaaaaggaattctttttgttgatacaacagaaacaaatgttttatatgatcgtatg
agaaatgaatttaatccaatagatatatcatcttataatgtttctgatatttcatggagt
gaacatcaagtcatgcaatcttatcacggaggaaagctggatcttattagtgtagtatta
agtaagatataa

DBGET integrated database retrieval system