Escherichia coli O157 H7 Sakai (EHEC): ECs_1206 Help Entry ECs_1206          CDS       T00048                                  Symbol stx2B Name (RefSeq) Shiga toxin 2 subunit B   KO K11007   shiga toxin subunit B Organism ecs  Escherichia coli O157:H7 Sakai (EHEC) Pathway ecs02024   Quorum sensing ecs05130   Pathogenic Escherichia coli infection Module ecs_M00363   EHEC pathogenicity signature, Shiga toxin Brite KEGG Orthology (KO) [BR:ecs00001]  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ECs_1206 (stx2B)  09160 Human Diseases   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     ECs_1206 (stx2B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02042 Bacterial toxins [BR:ecs02042]     ECs_1206 (stx2B) Bacterial toxins [BR:ecs02042]  Type III toxins: Intracellular toxins   Others    Shiga toxin     ECs_1206 (stx2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SLT_beta Peptidase_C28 PCC_BT Motif Other DBs NCBI-GeneID:  912579 NCBI-ProteinID:  NP_309233 UniProt:  A7UQX3 Structure PDB LinkDB All DBs Position 1268078..1268347 Genome browser AA seq 89 aa AA seqDB search MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS AQLTGMTVTIKSSTCESGSGFAEVQFNND NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga tttgctgaagtgcagtttaataatgactga

Escherichia coli O157 H7 Sakai (EHEC): ECs_2973 Help Entry ECs_2973          CDS       T00048                                  Symbol stx1B Name (RefSeq) Shiga toxin 1 subunit B   KO K11007   shiga toxin subunit B Organism ecs  Escherichia coli O157:H7 Sakai (EHEC) Pathway ecs02024   Quorum sensing ecs05130   Pathogenic Escherichia coli infection Module ecs_M00363   EHEC pathogenicity signature, Shiga toxin Brite KEGG Orthology (KO) [BR:ecs00001]  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ECs_2973 (stx1B)  09160 Human Diseases   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     ECs_2973 (stx1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02042 Bacterial toxins [BR:ecs02042]     ECs_2973 (stx1B) Bacterial toxins [BR:ecs02042]  Type III toxins: Intracellular toxins   Others    Shiga toxin     ECs_2973 (stx1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SLT_beta PCC_BT Motif Other DBs NCBI-GeneID:  916677 NCBI-ProteinID:  NP_311000 UniProt:  Q7DH26 LinkDB All DBs Position complement(2924625..2924894) Genome browser AA seq 89 aa AA seqDB search MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL LSAQITGMTVTIKTNACHNGGGFSEVIFR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system