KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_2715
Entry
ECs_2715          CDS       T00048                                 
Symbol
tccP_espFU_espF2-2
Name
(RefSeq) T3SS secreted effector TccP
  KO
K12789  Tir-cytoskeleton coupling protein
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs02024  Quorum sensing
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECs_2715 (tccP_espFU_espF2-2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_2715 (tccP_espFU_espF2-2)
SSDB
Motif
Pfam: EspF
Other DBs
NCBI-GeneID: 912330
NCBI-ProteinID: NP_310742
UniProt: P0DJ88
LinkDB
Position
2669688..2670701
AA seq 337 aa
MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPN
AHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQ
NEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQR
LVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPA
RNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNW
PAPTPPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgattaacaatgtttcttcactttttccaaccgtcaaccgcaatattacagctgtatat
aaaaaaagcagcttctctgtatcaccacagaaaatcacattaaatcctgtaaaaatcagc
tcacctttttcaccaagcagtagctccatcagcgcaacaactctctttcgagccccaaac
gcccattcggcatcatttcatcgacagtctactgctgaaagttcgttacatcaacaactt
cctaatgtgaggcagcgcctgatacaacatcttgcagagcatggcattaaacctgcccgg
agtatggctgaacatattcctccggcacctaactggcctgcgccaccaccgccagtacaa
aatgaacaatcaagacctctgcctgatgtggctcagcgtctggtgcagcatcttgcagag
catggcattcaaccagcccggaatatggctgaacatattcctccggcacctaactggcct
gcgccaccactgccagtacaaaatgaacaatcaagacctctgcctgatgtggctcagcgt
ctggtgcagcatcttgcagagcatggcattcaaccagcccggagtatggctgaacatatt
cctccggcacctaactggcctgcgccaccaccgccagtacaaaatgaacaatcaagacct
ctgcctgatgtggctcagcgtctgatgcagcatcttgcagagcatggcattcaaccagcc
cggaatatggctgaacatattcctccggcacctaactggcctgcgccaacgccgccagta
caaaatgaacaatcaagacctttgcctgatgtggctcagcgtctgatgcagcatcttgca
gagcatggcattcaaccagcccggaatatggctgaacatattcctccggcacctaactgg
cctgcgccaacgccgccagtacaaaatgaacaatcaagacctttgcctgatgtggctcag
cgtctgatgcagcatcttgcagagcatggcattaatacatctaagcgctcgtga

DBGET integrated database retrieval system