KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_3717
Entry
ECs_3717          CDS       T00048                                 
Symbol
eprJ
Name
(RefSeq) type III secretion protein EprJ
  KO
K22487  type III secretion system protein
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_3717 (eprJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecs02044]
    ECs_3717 (eprJ)
Secretion system [BR:ecs02044]
 Type III secretion system
  Type III secretion related proteins
   ECs_3717 (eprJ)
SSDB
Motif
Pfam: T3SS_basalb_I T3SS_needle_F
Other DBs
NCBI-GeneID: 916459
NCBI-ProteinID: NP_311744
UniProt: Q8X6G5
LinkDB
Position
complement(3720062..3720394)
AA seq 110 aa
MSVSNMPPIDRAEQSTAHEIQQAKVIDLNDRVLNLDNPDDKMISAFANYAVQTENWQQNA
LQALTSDKKGLTPEKLLVLQDHVLNYNVEVSLVGTLARKIVAAVETLTRS
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcagtaagcaatatgccacctattgatagagctgagcaatcaactgctcatgaaata
cagcaagcgaaagtgattgatttaaatgaccgggttctcaatcttgacaacccggatgat
aaaatgatctccgcttttgctaactatgctgtacaaactgaaaattggcagcaaaatgcg
ttacaagcattaacgtctgataaaaaaggattaactcctgaaaaattattagtcttgcag
gatcatgtgcttaattataatgtcgaggtttcattggtgggaacattagcaagaaaaatt
gtcgctgcagttgagacgttgacccgctcatga

DBGET integrated database retrieval system