KEGG   Escherichia coli O157 H7 Sakai (EHEC): ECs_3858
Entry
ECs_3858          CDS       T00048                                 
Symbol
nleE
Name
(RefSeq) T3SS secreted effector NleE
  KO
K23654  T3SS secreted effector NleE
Organism
ecs  Escherichia coli O157:H7 Sakai (EHEC)
Pathway
ecs05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecs00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECs_3858 (nleE)
SSDB
Motif
Pfam: NleE
Other DBs
NCBI-GeneID: 916318
NCBI-ProteinID: NP_311885
UniProt: Q7DBA6
LinkDB
Position
3864779..3865453
AA seq 224 aa
MINPVTNTQGVSPINTKYAEHVVKNIYPEIKHDYFNESPNIYDKKYISGITRGVAELKQE
EFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNP
DLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgattaatcctgttactaatactcagggcgtgtcccctataaatactaaatatgctgaa
catgtggtgaaaaatatttacccggaaattaaacatgattactttaatgaatcacccaat
atatatgataagaagtatatatccggtataaccagaggagtagctgaactaaaacaggaa
gaatttgttaacgagaaagccagacggttttcttatatgaagactatgtattctgtatgt
ccagaagcgtttgaacctatttccagaaatgaagccagtacaccggaaggaagctggcta
acagttatatccggaaaacgcccaatggggcagttttctgtagatagtttatacaatcct
gatttacatgcattatgtgagcttccggacatttgttgtaagatcttccctaaagaaaat
aatgattttttatacatagttgttgtgtacagaaatgacagccctctaggagaacaacgg
gcaaatagatttatagaattatataatataaaaagagatatcatgcaggaattaaattat
gagttaccagagttaaaggcagtaaaatctgaaatgattatcgcacgtgaaatgggagaa
atctttagctacatgcctggggaaatagacagttatatgaaatacataaataataaactt
tctaaaattgagtag

DBGET integrated database retrieval system