Electrophorus electricus (electric eel): 113585165 Help Entry 113585165         CDS       T05787                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism eee  Electrophorus electricus (electric eel) Pathway eee04060   Cytokine-cytokine receptor interaction eee04218   Cellular senescence eee04620   Toll-like receptor signaling pathway eee04621   NOD-like receptor signaling pathway eee04622   RIG-I-like receptor signaling pathway eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113585165  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113585165  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113585165    04621 NOD-like receptor signaling pathway     113585165    04622 RIG-I-like receptor signaling pathway     113585165  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113585165  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eee04052]     113585165    00536 Glycosaminoglycan binding proteins [BR:eee00536]     113585165 Cytokines and neuropeptides [BR:eee04052]  Cytokines   Chemokines    113585165 Glycosaminoglycan binding proteins [BR:eee00536]  Heparan sulfate / Heparin   Chemokines    113585165 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  113585165 NCBI-ProteinID:  XP_026878310 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MRVFLLFILMTNGLLFSYALQPLGKGYNSRCMCLQLETRIIPPHSLRSVEIINRGSHCKN IEVIAGLVSGERICLNPRTVWVKKLVHFIEKKKNETKKL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagggtttttctcctgttcattctaatgacaaatggccttctcttcagttatgcattg cagcctcttggaaaaggttacaacagccgctgcatgtgtctgcagctagagaccaggatc atccctccccacagcctccgaagtgtagagatcatcaacagaggttctcattgcaaaaac atagaggtcattgctggcttggtgagtggagagaggatttgtctgaatcctcggactgta tgggttaagaagcttgttcacttcattgaaaagaaaaaaaatgagacaaagaaattataa

DBGET integrated database retrieval system