Eumetopias jubatus (Steller sea lion): 114203804 Help Entry 114203804         CDS       T07240                                  Symbol IKBKG Name (RefSeq) NF-kappa-B essential modulator   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju01523   Antifolate resistance eju04010   MAPK signaling pathway eju04014   Ras signaling pathway eju04062   Chemokine signaling pathway eju04064   NF-kappa B signaling pathway eju04151   PI3K-Akt signaling pathway eju04210   Apoptosis eju04380   Osteoclast differentiation eju04620   Toll-like receptor signaling pathway eju04621   NOD-like receptor signaling pathway eju04622   RIG-I-like receptor signaling pathway eju04623   Cytosolic DNA-sensing pathway eju04625   C-type lectin receptor signaling pathway eju04657   IL-17 signaling pathway eju04658   Th1 and Th2 cell differentiation eju04659   Th17 cell differentiation eju04660   T cell receptor signaling pathway eju04662   B cell receptor signaling pathway eju04668   TNF signaling pathway eju04920   Adipocytokine signaling pathway eju04936   Alcoholic liver disease eju05010   Alzheimer disease eju05132   Salmonella infection eju05135   Yersinia infection eju05142   Chagas disease eju05145   Toxoplasmosis eju05160   Hepatitis C eju05161   Hepatitis B eju05162   Measles eju05163   Human cytomegalovirus infection eju05164   Influenza A eju05165   Human papillomavirus infection eju05166   Human T-cell leukemia virus 1 infection eju05167   Kaposi sarcoma-associated herpesvirus infection eju05168   Herpes simplex virus 1 infection eju05169   Epstein-Barr virus infection eju05170   Human immunodeficiency virus 1 infection eju05171   Coronavirus disease - COVID-19 eju05200   Pathways in cancer eju05203   Viral carcinogenesis eju05208   Chemical carcinogenesis - reactive oxygen species eju05212   Pancreatic cancer eju05215   Prostate cancer eju05220   Chronic myeloid leukemia eju05221   Acute myeloid leukemia eju05222   Small cell lung cancer eju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer eju05340   Primary immunodeficiency eju05417   Lipid and atherosclerosis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114203804 (IKBKG)    04014 Ras signaling pathway     114203804 (IKBKG)    04064 NF-kappa B signaling pathway     114203804 (IKBKG)    04668 TNF signaling pathway     114203804 (IKBKG)    04151 PI3K-Akt signaling pathway     114203804 (IKBKG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     114203804 (IKBKG)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114203804 (IKBKG)    04621 NOD-like receptor signaling pathway     114203804 (IKBKG)    04622 RIG-I-like receptor signaling pathway     114203804 (IKBKG)    04623 Cytosolic DNA-sensing pathway     114203804 (IKBKG)    04625 C-type lectin receptor signaling pathway     114203804 (IKBKG)    04660 T cell receptor signaling pathway     114203804 (IKBKG)    04658 Th1 and Th2 cell differentiation     114203804 (IKBKG)    04659 Th17 cell differentiation     114203804 (IKBKG)    04657 IL-17 signaling pathway     114203804 (IKBKG)    04662 B cell receptor signaling pathway     114203804 (IKBKG)    04062 Chemokine signaling pathway     114203804 (IKBKG)   09152 Endocrine system    04920 Adipocytokine signaling pathway     114203804 (IKBKG)   09158 Development and regeneration    04380 Osteoclast differentiation     114203804 (IKBKG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     114203804 (IKBKG)    05208 Chemical carcinogenesis - reactive oxygen species     114203804 (IKBKG)    05203 Viral carcinogenesis     114203804 (IKBKG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     114203804 (IKBKG)   09162 Cancer: specific types    05212 Pancreatic cancer     114203804 (IKBKG)    05221 Acute myeloid leukemia     114203804 (IKBKG)    05220 Chronic myeloid leukemia     114203804 (IKBKG)    05215 Prostate cancer     114203804 (IKBKG)    05222 Small cell lung cancer     114203804 (IKBKG)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     114203804 (IKBKG)    05170 Human immunodeficiency virus 1 infection     114203804 (IKBKG)    05161 Hepatitis B     114203804 (IKBKG)    05160 Hepatitis C     114203804 (IKBKG)    05171 Coronavirus disease - COVID-19     114203804 (IKBKG)    05164 Influenza A     114203804 (IKBKG)    05162 Measles     114203804 (IKBKG)    05168 Herpes simplex virus 1 infection     114203804 (IKBKG)    05163 Human cytomegalovirus infection     114203804 (IKBKG)    05167 Kaposi sarcoma-associated herpesvirus infection     114203804 (IKBKG)    05169 Epstein-Barr virus infection     114203804 (IKBKG)    05165 Human papillomavirus infection     114203804 (IKBKG)   09171 Infectious disease: bacterial    05132 Salmonella infection     114203804 (IKBKG)    05135 Yersinia infection     114203804 (IKBKG)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     114203804 (IKBKG)    05142 Chagas disease     114203804 (IKBKG)   09163 Immune disease    05340 Primary immunodeficiency     114203804 (IKBKG)   09164 Neurodegenerative disease    05010 Alzheimer disease     114203804 (IKBKG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114203804 (IKBKG)    05418 Fluid shear stress and atherosclerosis     114203804 (IKBKG)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     114203804 (IKBKG)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     114203804 (IKBKG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:eju01001]     114203804 (IKBKG) Protein kinases [BR:eju01001]  Serine/threonine kinases: Other   IKK family [OT]    114203804 (IKBKG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CC2-LZ zf_C2H2_10 NEMO LLC1 Bacillus_HBL Nairovirus_NSm Motif Other DBs NCBI-GeneID:  114203804 NCBI-ProteinID:  XP_027952903 LinkDB All DBs Position Unknown AA seq 349 aa AA seqDB search MLRERCEELQHFQGSQRKEKEFLMQKFQEARKLVERLNLEKLDLRRQREQALQEVEHLKR CQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQARQLESERET LQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVV SSERNRGMQLEDLRQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKA DFQAERQAREQLAEKKEFLQEQLEQLQREYSRLKASCQESARIEDLRKRHVEVSQAPLPP TPAHPSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt atgcttcgggagcgctgcgaggagctacagcatttccagggcagccagaggaaggagaag gagttcctcatgcagaagttccaggaagccaggaaactggtagagagactgaacctggag aagctcgacctgaggaggcagagggagcaggccctgcaggaggtggaacatctgaagaga tgccagcagcagatggctgaggacaaggcctctgtgaaagcccaggtgacatccttgctg ggggagctccaagagagccagagtcgtttggaggccgccaccaaggagcggcaggctttg gagggcagggcccgagctgctagcgagcaggcccggcagctggagagcgagcgggagacg ctgcagcagcagcacagcgtgcaggtggaccagctgcgcatgcagagccagagcgtggag gcggccctgcgcatggagcgccaggctgcctcggaggagaagcggaagctggcccagctg caggtggcctatcaccagctcttccaagagtatgacaaccacatcaagagcagcgtggtg agcagtgagcgaaaccgaggaatgcagctggaggatctcaggcagcagctccagcaggcc gaggaggccctggtggccaaacaggaagtgattgacaagctgaaggaagaggccgagcag cacaagattgtgatggagactgtcccggtgctgaaggctcaggcggatatctacaaggcc gacttccaggccgagaggcaggcccgggaacaactggcggagaagaaggagttcctgcag gagcagctggagcagctgcagagggaatacagcaggctgaaggccagctgtcaggagtcg gccaggattgaagatctgaggaagcggcacgtggaggtctcccaggcccccttacccccc accccagctcacccctcctttcacctggccctgcccagccagaggagaagcccccccgag gagccgcctgacttctgttgccccaagtgccagtatcaggctcctgatatggacaccctg cagatacatgtcatggagtgcatcgagtag

DBGET integrated database retrieval system