Eumetopias jubatus (Steller sea lion): 114207761 Help Entry 114207761         CDS       T07240                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04144   Endocytosis eju04510   Focal adhesion eju05020   Prion disease eju05100   Bacterial invasion of epithelial cells eju05205   Proteoglycans in cancer eju05410   Hypertrophic cardiomyopathy eju05412   Arrhythmogenic right ventricular cardiomyopathy eju05414   Dilated cardiomyopathy eju05416   Viral myocarditis eju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114207761 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     114207761 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     114207761 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     114207761 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     114207761 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     114207761 (CAV3)    05410 Hypertrophic cardiomyopathy     114207761 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     114207761 (CAV3)    05414 Dilated cardiomyopathy     114207761 (CAV3)    05416 Viral myocarditis     114207761 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eju04131]     114207761 (CAV3) Membrane trafficking [BR:eju04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     114207761 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  114207761 NCBI-ProteinID:  XP_027957581 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQICSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggctgaagagcacacagacctggaggcccagattgtcaaggacatccactgcaag gagatcgacctggtgaaccgagaccccaagaacattaacgaggacatagtgaaggtggat ttcgaagatgtgatcgcagagcccgtgggcacctacagcttcgacggcgtgtggaaggtg agctacaccaccttcacggtctccaagtactggtgctaccgcctgctgtccacactgctg ggagtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcagtggtgccgtgcattaagagctacctgatcgagatccagtgcatcagccacatc tactccctttgcatccgcaccttctgtaacccgctctttgccgccctgggccagatttgc agcaacatcaaagtgatgctccggaaggaagtgtaa

DBGET integrated database retrieval system