Eumetopias jubatus (Steller sea lion): 114212881 Help Entry 114212881         CDS       T07240                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju03030   DNA replication eju03082   ATP-dependent chromatin remodeling eju03410   Base excision repair eju03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eju00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     114212881 (POLE3)    03410 Base excision repair     114212881 (POLE3)    03420 Nucleotide excision repair     114212881 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114212881 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eju03032]     114212881 (POLE3)    03036 Chromosome and associated proteins [BR:eju03036]     114212881 (POLE3)    03400 DNA repair and recombination proteins [BR:eju03400]     114212881 (POLE3) Enzymes [BR:eju01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      114212881 (POLE3) DNA replication proteins [BR:eju03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     114212881 (POLE3) Chromosome and associated proteins [BR:eju03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     114212881 (POLE3) DNA repair and recombination proteins [BR:eju03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       114212881 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C BUD22 CIS_TMP SpoU_methylase DUF5427 DUF4746 TAF RNA_pol_3_Rpc31 Pox_Ag35 Spore_coat_CotO DDHD DUF6080 CDC45 V_ATPase_I Motif Other DBs NCBI-GeneID:  114212881 NCBI-ProteinID:  XP_027963706 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDAEEPD KSRDEDNDEEEERLEEEEQNEEEEVDN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcggagaggcccgaggacttaaacctgcccaatgccgtcatcactaggatcatcaag gaagcgctcccggacggtgtcaacatctccaaggaggcccgcagcgccatctcccgcgct gctagcgtcttcgtgctgtacgccacttcctgtgccaacaactttgcaatgaaagggaaa cgcaagacactgaacgccagtgacgtgctctcagccatggaagagatggagttccagcgg ttcgttaccccgttgaaagaagctctggaagcatacaggagagagcagaaaggcaagaag gaagcttcagagcaaaagaagaaggacaaagacaaaaaaacagatgcagaagagccagac aagagcagggatgaagacaacgatgaagaggaggaaaggctggaagaagaagaacagaat gaagaggaggaagtggacaactaa

DBGET integrated database retrieval system