KEGG   Eumetopias jubatus (Steller sea lion): 114213247
Entry
114213247         CDS       T07240                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:eju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114213247 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:eju04050]
    114213247 (TNFRSF8)
   04090 CD molecules [BR:eju04090]
    114213247 (TNFRSF8)
Cytokine receptors [BR:eju04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114213247 (TNFRSF8)
CD molecules [BR:eju04090]
 Proteins
  114213247 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 114213247
NCBI-ProteinID: XP_027964121
LinkDB
Position
Unknown
AA seq 508 aa
MFCATPVINTCARCIPHSVCPPGMVVRFRGTAERDTICEPLSPVTSPDCSTSPEACQAPA
RRIGSAISGFSLSSRPPQARPLGTSSASSKARTTLPGGGASLTPENDSKMTRAPSSPSSV
RKPSPNPGLTSQQPCAQGSSDCGKQCDPDYYLDRDGRCKACVSCSGDLVEKAPCTWNSSR
VCECRSGMFCATSATNSCARCIPHSVCPPGMVTKPQGAAERDATDELPPPEACPECSTNP
EDSKTPTSAPAPLVSSADPQISQEHGGGISHAWGDTPISTSTPISFSSTAKPILVSGPVL
SWTVLLLVVVLGSVSFLLCHRRACRKWIQQKLHLCYRVQTFRLKVEPVDSRPWRNPTQLK
SISVVESGMEERGLMSPPAVETSSPNGAACVESMRLLEARPPAAGSPPSPGDLPEPRVTS
EHTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLAGPAGPEFEEDLEVDHAPHFPEQETEP
PLGSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttctgtgccacaccagtcatcaatacctgtgcccgctgtatcccccactccgtctgc
ccaccagggatggtcgtcaggttccggggtacagcagagagggacaccatctgtgagcca
ctctccccagtgaccagccctgactgcagcaccagccccgaagcctgccaggcgcccgcc
aggagaattggcagtgccatttctggcttctctctcagcagcaggcccccccaggccagg
cccctggggacttcctcagcaagctccaaggccaggaccacacttcctggagggggtgct
tccctcaccccggaaaatgattccaaaatgaccagggcccccagctctccctcctcagtg
cggaagcccagtcccaatccagggctgacctcgcagcagccgtgcgcgcagggctcatcg
gactgcgggaagcagtgtgaccccgactactacctggacagggacggccgctgcaaggcc
tgtgtgagctgttctggagacctggtggagaaggcgccgtgcacgtggaactcctctcga
gtctgcgaatgtcgatctggcatgttctgtgccacatcagccaccaactcctgtgcccgc
tgtatcccccactccgtctgcccaccagggatggtcaccaaaccccagggtgcagctgag
agggatgccacagatgagctacctccccccgaggcctgccctgagtgcagcaccaaccca
gaggacagcaagacgcccaccagtgcccctgcccctctggtgtcctcggcagacccccag
atcagtcaggagcatggagggggcatctcccacgcctggggagacacccccatatcaacg
agcacgcccatctctttctcctccacggcaaagcccattctggtttcagggccggtgctc
tcctggacggtcctgctgctggtggtggtcctgggctccgtgtccttcctcctgtgccac
cggagggcctgcaggaagtggattcagcagaagctccacctctgctaccgtgtccagacc
ttccggctcaaggtggagcccgtggattccaggccctggaggaacccgacacagctgaag
agcatatcggtggtggagtcaggcatggaagagcgggggttaatgagccccccggctgtg
gagacctcctcccccaatggggcagcctgcgtagagagcatgcggctgctggaagccagg
ccccccgccgccgggagccccccatcccccggggacctccccgagccccgggtgacctcg
gagcataccaacaacaggatcgagaagatctacatcatgaaggctgacacggtgattgtg
gggaccgtgaggaccgaggtgcccgagggccggggcctggcggggccggcggggcctgag
ttcgaggaggatctggaagtggaccatgccccccacttcccagagcaggagacggagcct
cctctgggcagctgtggggatgtcatgttctcagtagaagaggaaggaaaggaggccccc
ttgcccatgaccgtctctgagaaatga

DBGET integrated database retrieval system