Eumetopias jubatus (Steller sea lion): 114213964 Help Entry 114213964         CDS       T07240                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism eju  Eumetopias jubatus (Steller sea lion) Pathway eju04060   Cytokine-cytokine receptor interaction eju04061   Viral protein interaction with cytokine and cytokine receptor eju04062   Chemokine signaling pathway eju04620   Toll-like receptor signaling pathway eju05142   Chagas disease eju05163   Human cytomegalovirus infection eju05323   Rheumatoid arthritis eju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     114213964    04061 Viral protein interaction with cytokine and cytokine receptor     114213964  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114213964    04062 Chemokine signaling pathway     114213964  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     114213964   09174 Infectious disease: parasitic    05142 Chagas disease     114213964   09163 Immune disease    05323 Rheumatoid arthritis     114213964   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     114213964  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eju04052]     114213964    00536 Glycosaminoglycan binding proteins [BR:eju00536]     114213964 Cytokines and neuropeptides [BR:eju04052]  Cytokines   Chemokines    114213964 Glycosaminoglycan binding proteins [BR:eju00536]  Heparan sulfate / Heparin   Chemokines    114213964 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  114213964 NCBI-ProteinID:  XP_027965155 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MKVILATLVFLLILAVLHSEANEEPVNKLTSHLCCFTYISRKVPLRIVKGYDRTSDQCPT PGVIFLIQQGRQICANPNVAWVQEYIRHLDHASKLSGSTGARMAKGV NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgatcctggctaccctggtcttcctcctcattcttgctgtcctccactctgag gccaatgaagaaccagttaataaattaacctcccatctgtgctgtttcacctacatctca cggaaggtcccactccggattgtgaaaggttatgacaggaccagtgaccagtgccccaca ccaggggtcatcttcctcatccaacagggccgacagatctgcgccaaccccaatgttgcc tgggtgcaggagtacatcagacacctagaccatgcgtctaagttgtctgggagcactggg gcccgcatggccaagggggtgtga

DBGET integrated database retrieval system