KEGG   Eumetopias jubatus (Steller sea lion): 114217609
Entry
114217609         CDS       T07240                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
eju  Eumetopias jubatus (Steller sea lion)
Pathway
eju04927  Cortisol synthesis and secretion
eju04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:eju00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    114217609 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114217609 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4
Other DBs
NCBI-GeneID: 114217609
NCBI-ProteinID: XP_027970322
LinkDB
Position
Unknown
AA seq 161 aa
MANQTNASTLYNSYEYYLDYLDLIPVDERKLKANKYLIVITFWASLAFFVMLLFLILLYM
SWSGSSQARNNAQHHPTCPWSNSPHLPLCLRRHPTRLHRARAKSQAAEHAALSSSCGHEP
PHLAPPCSPPGTGRPWGPPTASADIRNTRGEPPPGDRTSQL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccctgtacaacagctacgaatactacctggactac
ttggacctcattcccgtggatgagaggaagctgaaagccaacaaatatttgattgtcatc
accttctgggcgagtctggcattcttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcaggctcctcacaggcgaggaacaacgcccagcaccacccaacatgtccctgg
agtaacagcccccacctccccctctgcctccggaggcaccccacaaggctccaccgagct
cgggcaaagagccaggcagcagagcatgcggccctgagcagcagctgtggccacgagccc
ccccaccttgccccaccctgctctcctccgggaactggccgtccatggggcccccccaca
gcatcagctgacatcaggaacacgcggggtgagccgccccctggagacagaacctctcaa
ctgtag

DBGET integrated database retrieval system