KEGG   Enhydra lutris kenyoni (northern sea otter): 111162188
Entry
111162188         CDS       T05871                                 
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04610  Complement and coagulation cascades
elk04810  Regulation of actin cytoskeleton
elk05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111162188
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111162188
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111162188
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:elk04515]
    111162188
   04090 CD molecules [BR:elk04090]
    111162188
Cell adhesion molecules [BR:elk04515]
 Integrins
  Integrin alpha subunits
   111162188
CD molecules [BR:elk04090]
 Proteins
  111162188
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 111162188
NCBI-ProteinID: XP_022382123
UniProt: A0A2Y9LA01
LinkDB
Position
Unknown
AA seq 1168 aa
MSDLPVMMRIRTSLLLLMALASSLCFNLDTDQPTIFLMDSAGFGHSVVQYGNTWVVVGAP
QEIKGTNQTGSLYRCDYSMGKCEPIHLQIPPEAVNMSLGLSLAASTSPSQLLACGPTVHR
TCRENMYLMGFCFLMGSSSWQAQRFPAALQECPRQEQDIVFLIDGSGSISSQDFTKMLNF
VKAVMSQFPKPSTQFSLMQFSDKFRVYFTFKEFTYSSKPLYLLDSIQQLRGYTHTATAIQ
IVTNELFSTSKGARKDASKILIVITDGQKQGDRLGYEDVIPMAEAAGIIRYAVGVGSAFR
YQHSWKELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSAVITPDGPVLGTVGSFSWSGGAFLYPQNKRPTFINMSQENVDMRDSYLGYSTELAF
WKGVQSLILGAPRHQHTGKAVIFTQASGQWRPKAEVAGTQIGSYFGASLCTVDVDRDGSS
DLVLIGAPHYYKPTRGGQVSVCPLPQGRAKWQCEVILCGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQESQGAVYLFHGTSGLGISPSHSQRISASQFSPSLQYFGQSLSGGQD
LTLDGLVDLAVGAQGQALLLRTRPVLRVWMRIQFKPAEIARSLFECREETSSVNALGDAN
VCLHIYESPKNRLGDLQSSVTFDLTLDPGRQSPRAVFEETKTRNLTRVRVLGLSQHCETV
KLCLLACVEDSVTPITLRLNFSLVGKPIPSYGNLRPMLAVDAQRYYTASLPFEKNCGTDH
VCQDDLGISFGFSGLKTLLVGSTLELNMRVMVWNDGEDSYGTTVTFFYPPGLSYRRVAGS
KKQLQPHSPLLTCDGTPAQGQDTQSTRCSINHLILHEGARITFLVTFDVSPKAMLGDRLL
LTANVSSENNTPRTSKSTFQMELMVKYAIYTVISSHEQSTKYLNFSASDQEGSSQAQHRY
QVNNLGQRDLPISIIFSVPVELNGVPVWTELEVFHPQNPSIQCSSERIVHTKSDFLTKNQ
KNYVLDCSIADCLRFCCDLPSFGVQEELDFILKGNISFGWVSQTLQKKVFVVSVAEITFN
RSVYSQLPGQEAFLRAQMETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFKR
QYKEMMAEASGQTVPENGTSDPQVAQNF
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgatgaggatcagaacatccctcctcttgttgatggccttg
gcttcttctctctgcttcaacttggacacagaccagccaacaattttccttatggacagt
gctggatttggacacagcgtggtccagtatggcaacacctgggtggtggttggagccccc
caggagataaagggtaccaaccaaacaggcagtctctaccggtgtgactacagcatgggc
aagtgtgagcccatccacctgcagatacccccagaagctgtgaacatgtccctgggcctg
tccctggcagcctccactagtccctctcagctgctggcctgtggccccacagtgcaccgt
acatgcagggagaacatgtacttgatggggttctgcttcctgatgggctcttcttcttgg
caagcccagaggttcccggctgccctgcaggaatgtccaaggcaagagcaggatatcgtg
ttcctgatcgatggctcaggcagcatctcctcccaggattttaccaagatgttgaatttt
gtgaaggctgtgatgagccagttcccgaaacctagcacccagttctccctgatgcagttt
tccgacaagttccgggtgtacttcactttcaaagagttcacatacagctcaaagccacta
tacctgttggattctatacagcagctgagagggtatactcacacagccacagccatccaa
atagtcacaaacgaactgttcagtacctcaaaaggagcccgaaaagatgcctccaagatc
ctcattgtcatcacagatgggcaaaaacaaggcgaccgcctgggttatgaggatgtcatc
cctatggctgaggctgcgggtatcatccgctatgcagttggggtgggatcagcttttcga
taccaacattcctggaaagaattgaatgacattgcatcgaagccctcacatgagtacatt
tttaaagtggagaattttgatgctttgagagacattcaaaaccaactaaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttcctttgaattggagatgtcccag
gagggcttcagtgctgtgatcacacctgatggaccagttctggggacagtggggagcttc
agctggtctggaggtgccttcctgtacccccaaaacaaaagacccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccactgagctggctttt
tggaagggggtccagagcctgatcctgggggccccccgccatcagcatactgggaaggct
gtcattttcacccaggcatctgggcaatggaggccgaaggctgaagttgcagggacccag
attggctcttactttggggcctccctctgcactgtggatgtggatagagatggcagctct
gaccttgtcctcatcggggctcctcattactataagccaacccgaggggggcaggtgtct
gtgtgccccttgccccaggggagggctaagtggcaatgtgaggtcattctctgtggggag
caaggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagatgtggccattggggctccaggagagcaggagagccagggtgctgtc
tacctatttcatggaacctcagggctgggcatcagcccctcccacagtcagaggatctca
gcctcccagttctctcccagcctccagtattttgggcagtcactgagtgggggccaagac
cttaccctggatggactggtggaccttgccgtgggggcccagggacaggcgctgctgctt
aggaccagacctgtactcagggtgtggatgcgaatccaattcaaacctgcagagatagcc
aggtctctgtttgagtgtcgcgaagagacctcctctgtcaatgcactgggtgatgctaat
gtctgtcttcatatttatgaaagtcccaagaatcggctgggtgacctccaaagctctgtg
acctttgacctaaccctcgaccctggccgccagagtccccgtgccgtctttgaggagaca
aaaacccggaatctgactcgtgtccgagtccttgggctgagtcaacactgtgagactgtg
aagttgtgcctcctggcctgcgtggaggactcggtgactcccatcaccttgcgtctcaac
ttttccctggtgggcaagcctatcccttcctatggaaacctccggcctatgttggctgtg
gatgctcagagatattatacagcctctctcccctttgagaagaattgtggaactgaccat
gtctgtcaggatgaccttggcatctcctttggcttctcaggcttgaagaccctgttggtg
gggagtaccctggagctgaatatgagagtgatggtgtggaatgatggtgaggactcctat
ggaaccacagtcaccttcttctatcctccagggttgtcttatcgacgtgtggcagggagt
aagaagcagctgcagccacactccccactcctgacctgtgatggcaccccagcccagggc
caggatactcagagcactcgctgcagcatcaaccacctcatcctccatgagggtgcccgg
atcaccttcctggtcacctttgatgtctcccccaaggccatgctgggggaccggctgctt
ctgacagctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacctttcag
atggagctcatggtgaagtatgccatctacaccgtgattagcagccatgaacagtccacc
aagtacctcaacttctcagcctcagaccaggagggaagcagccaggctcagcatagatac
caggtgaacaacttgggacagagggacctgcctatcagcatcatcttctctgtgcctgtg
gagctgaatggggtacctgtgtggacagaattagaggtcttccacccccagaatccctcc
attcagtgctcttcagagagaatagttcacacaaagtctgacttcctgaccaaaaatcag
aagaattatgtgctggactgctccattgctgactgtctgaggttctgctgtgacctccct
tcctttggcgtccaggaggaacttgacttcatcctgaagggcaacatcagttttggttgg
gtcagccagacattgcagaagaaggtatttgtggtgagtgtggctgaaatcacattcaac
agatccgtgtattcccagcttccaggacaggaggcattcttgagagctcagatggagacg
gtgctggagaagtatgaggtctacaatcctatccccataattgtgggcagctctgtggga
ggactgctactgttggctctcatcacagccatcctgtacaaggttggcttcttcaaacgt
cagtataaggaaatgatggcagaagcaagtggacagactgtcccagaaaatgggacttcg
gaccctcaagttgcccaaaacttctga

DBGET integrated database retrieval system