KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_07745
Entry
ECO55CA74_07745   CDS       T02066                                 

Definition
(GenBank) hypothetical protein
  KO
K23658  T3SS secreted effector NleF
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-ProteinID: AEZ40145
LinkDB
Structure
PDB: 
3V3K

Position
1616963..1617532
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNN
ELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSL
KVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLT
YNKGSLQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggttcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgagcttaatcataatcactttctttctcct
gaattacaagataaacttgatgttatggtctctatatattcatgtgccagaaataataat
gagcttgaggaaatttttcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcgctgagggcg
ggaatgacgatagaggatagggatagttatatcagggatcttttttttctgcattcattg
aaagtaaaaattgaggaaagtagacaaggcaaagaagattcgaaatgtaaagtttataat
ctgctatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgcctc
gtggaaggatgcagtgatgattttaatccttttgatattattagggtaccagatcttact
tacaacaaaggatctttacaatgtggatga

DBGET integrated database retrieval system