Escherichia coli W: ECW_m1090 Help Entry ECW_m1090         CDS       T02002                                  Symbol yccB Name (GenBank) small stress response protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism elw  Escherichia coli W Pathway elw00190   Oxidative phosphorylation elw01100   Metabolic pathways elw02020   Two-component system Module elw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:elw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECW_m1090 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECW_m1090 (yccB) Enzymes [BR:elw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECW_m1090 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  ADT74591 UniProt:  E0IZ63 LinkDB All DBs Position 1148631..1148723 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system