KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_1748
Entry
CDCO157_1748      CDS       T02122                                 
Name
(GenBank) bfpT-regulated chaperone-like protein
  KO
K23653  T3SS effector EspM
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:elx00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_1748
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: AFJ28805
LinkDB
Position
1813616..1814206
AA seq 196 aa
MPVNATGVSFSSFGISYHKDNSFRGTIRGKNDEVVKCSMGERSIRFNVNKFSGCILETVS
RQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKISSEERKMVFSLVSKEFELTLDV
KAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNSTTDYIANVLADKFYQKHIAPGVDIV
KLRNEIPGYMSRVIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccagtaaatgcgacaggtgtgtccttcagctcttttggtatcagttatcataaagat
aattctttccggggcaccatccgtgggaagaatgatgaggtcgtgaagtgttcaatggga
gagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacggtaagc
aggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatatccgtca
agggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatttcttct
gaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactcttgatgtt
aaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggcaaaaaa
atggatgctctttgcgatggtatgagccgagctgtaaaaaacagtacaacagattacata
gcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgatattgta
aaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system