KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3250
Entry
CDCO157_3250      CDS       T02122                                 
Name
(GenBank) chaperone-like protein
  KO
K23653  T3SS effector EspM
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:elx00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_3250
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: AFJ30306
LinkDB
Position
complement(3404618..3405208)
AA seq 196 aa
MPMNTTGMSFSSFGISCHRENSFRNSFRGKNDEVVKCSIGERTISFSVRKFSGNILETVR
RQSTKDIDEWIKDERIVYPSRVINQEIDNYCFQKNAKISTEERQRVFFLVSQENQLTLDV
KAAQSSINHVIMGSASFGKKMDALCDGMSRDVKNRTSDTIANLLADKFYQKHIDSDIDIV
KLRNDIPDYLMRAIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccgatgaatactacaggtatgtctttcagctcttttggtataagttgccatagagag
aactccttcaggaactctttccgagggaagaatgatgaggtcgtaaaatgttcaattgga
gaacggactattagcttttctgttcgcaaatttagcggcaatatactggaaacggtgaga
aggcagagtactaaagatattgatgagtggataaaagatgaacggatagtatatccctca
agggtgatcaaccaggagattgataattactgttttcaaaaaaatgcaaaaatttccact
gaagagaggcaaagagtcttttttcttgtgagccaggagaatcaactaacccttgatgtt
aaggcagcacaaagttctattaatcatgtaataatggggagtgcttcttttggcaagaaa
atggatgctctttgtgatggtatgagccgggatgtaaaaaatcgtacatcagataccata
gcaaacttgcttgcggacaagttttaccagaaacatatcgattcggatattgatattgta
aaactacgaaatgatatcccagattatttgatgcgtgctatacagggatga

DBGET integrated database retrieval system