KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2059
Entry
ECO103_2059       CDS       T01096                                 
Name
(GenBank) T3SS secreted effector EspM-like protein
  KO
K23653  T3SS effector EspM
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO103_2059
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3 RTX_C DUF4318
Other DBs
NCBI-ProteinID: BAI30856
LinkDB
Position
complement(2141437..2142027)
AA seq 196 aa
MPMKTTGTSFSSFGVSCHRENSFRNPFRGKNDEVIKCSIGERTIRFSVDKFSGNILDTVR
RQSAKNIDGWVKDEQMVYPSRVINQEIDNYCLQRNEKITTEVKQRVFSLVSQKYQLSLDI
KAAQSSINHVIMGNASFGKKIDALCDGMSRDVKNRTSDSIANLLADKFYQKHIDSDIDIV
KLRNEIPDYLRFAIQA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccgatgaagactacaggtacatctttcagctcttttggtgtaagttgtcatagagaa
aattcctttcggaaccctttccgagggaagaatgatgaggtcataaaatgttcaattgga
gagcggactattcgcttttctgttgacaaatttagcggcaatatactggatacagtgcgc
aggcagagtgctaaaaatattgatgggtgggtgaaagatgaacagatggtatatccatca
agggtgatcaatcaggagattgataattactgtcttcaaagaaatgaaaaaattactact
gaagtgaagcaaagagtcttttctcttgtgagtcaaaaatatcaactaagtcttgatatt
aaggcagcacaaagttctattaatcatgtaataatggggaatgcttcttttggcaagaaa
atagatgctctttgtgatggtatgagccgggatgtaaaaaatcgtacatcagatagcata
gcaaacttgcttgcggacaagttttaccagaaacatatcgattcggatattgatattgtg
aaactacgaaatgagatcccagattatttgaggtttgctatacaggcataa

DBGET integrated database retrieval system