KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3562
Entry
ECO103_3562       CDS       T01096                                 
Symbol
nleE
Name
(GenBank) T3SS secreted effector NleE-like protein
  KO
K23654  T3SS secreted effector NleE
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO103_3562 (nleE)
SSDB
Motif
Pfam: NleE
Other DBs
NCBI-ProteinID: BAI32293
LinkDB
Position
3639773..3640447
AA seq 224 aa
MINPVTNTQGVSPINTKYAEHVVKNIYPEIKHDYFNESPNIYDKKYISGITRGVAELKQE
EFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNP
DLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgattaatcctgttactaatactcagggcgtgtcccctataaatactaaatatgctgaa
catgtggtgaaaaatatttacccggaaattaaacatgattactttaatgaatcacccaat
atatatgataagaagtatatatccggtataaccagaggagtagctgaactaaaacaggaa
gaatttgttaacgagaaagccagacggttttcttatatgaagactatgtattctgtatgt
ccagaagcgtttgaacctatttccagaaatgaagccagtacaccggaaggaagctggcta
acagttatatccggaaaacgcccaatggggcagttttctgtagatagtttatacaatcct
gatttacatgcattatgtgagcttccggacatttgttgtaagatcttccctaaagaaaat
aatgattttttatacatagttgttgtgtacagaaatgacagccctctaggagaacaacgg
gcaaatagatttatagaattatataatataaaaagagatatcatgcaggaattaaattat
gagttaccagagttaaaggcagtaaaatctgaaatgattatcgcacgtgaaatgggagaa
atctttagctacatgcctggggaaatagacagttatatgaaatacataaataataaactt
tctaaaattgagtag

DBGET integrated database retrieval system