KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0344
Entry
G2583_0344        CDS       T01190                                 
Name
(GenBank) Putative chaperone protein
  KO
K23653  T3SS effector EspM
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_0344
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: ADD54985
UniProt: D3QXM7
LinkDB
Position
346816..347406
AA seq 196 aa
MPMNTTGTSFSSFGISCHRENSFRNSFRGKNDEVIKCSMGERTIHFSVRKFSGNILETVR
RQSTKDIDEWIKDERIVYPSRVINQEIDNYCFQKNAKISTEERQRVFFLVSQENQLTLDV
KAAQSSINHVIMGSASFGKKMDALCDGMSRDVKNRTSDTIANLLADKFYQKHIESDIDIV
KLRNEIPDYLRCAIRA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccgatgaatactacaggtacgtctttcagctcttttggtataagttgccatagagaa
aactccttcaggaactctttccgagggaagaatgatgaggtcataaaatgttcaatggga
gaacggacgattcacttttctgttcgcaaatttagcggcaatatactggaaacggtgaga
aggcagagtactaaagatattgatgagtggataaaagatgaacggatagtatatccctca
agggtgatcaaccaggagattgataattactgttttcaaaaaaatgcaaaaatttccact
gaagagaggcaaagagtcttttttcttgtgagccaggagaatcaactaacccttgatgtt
aaggcagcacaaagttctattaatcatgtaataatggggagtgcttcttttggcaagaaa
atggatgctctttgtgatggtatgagccgggatgtaaaaaatcgtacatcagataccata
gcaaacttgcttgcggacaagttttaccagaaacatatcgagtcggatattgatattgta
aaactacgaaatgagatcccagattatttgaggtgtgccatacgggcataa

DBGET integrated database retrieval system