KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0996
Entry
G2583_0996        CDS       T01190                                 
Symbol
nleC
Name
(GenBank) Non-LEE encoded type III effector C
  KO
K23655  T3SS secreted effector NleC
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_0996 (nleC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eok01002]
    G2583_0996 (nleC)
Peptidases and inhibitors [BR:eok01002]
 Metallo peptidases
  Family M85
   G2583_0996 (nleC)
SSDB
Motif
Pfam: Peptidase_M85
Other DBs
NCBI-ProteinID: ADD55599
UniProt: D3QNI4
LinkDB
Position
1022693..1023685
AA seq 330 aa
MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAV
HDSRSRLIDQHTVDMIGNTVLDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEES
SVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPYVSFSVAPDTDSYEMPSWQEG
LIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN
LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAIN
DNLQDANQIQLYHGAPYIFTFGDVDKHNQQ
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaaaattccctcattacagtccaacttcaacttttccgccccggcaggatactctgct
cccattgctcctaatcgtgctgaaaatgcctatgcggattacgttttggatataggtaag
cgaataccactttccgcagcagatttaagcaacgtatacgaaagtgtaatacgcgccgtc
catgacagccgtagcaggcttatcgatcagcatacagtcgatatgatcggcaacactgta
cttgatgctttgagccgatcacagacatttcgtgatgccgtaagctatggcattcataat
gagaaggtacacattggttgcattaaatacagaaacgaatacgagcttaacgaagaatct
tctgtcaaaattgatgatattcaatcactaacctgtaacgaattatatgaatatgatgtc
gggcaagagccaattttccccatttgcgaagcaggagaaaacgataacgaagagccttat
gtcagttttagtgttgcgccagatactgactcttatgagatgccatcgtggcaggaagga
ctgattcacgagattattcatcatgttactggatctagcgatccatctggagatagtaat
atagagttaggacccaccgagattctcgcacgtcgtgtcgctcaagaactgggatggagt
gttcccgacttcaaaggatatgcagagccagaacgtgaagctcatcttaggctacgtaac
ctgaatgcccttcgacaggctgccatgaggcatgaagagaatgagagggctttcttcgaa
aggctgggtacgatcagtgaccgatatgaggcgagtcctgatttcacagagtattccgct
gtgtctaacataggatacggatttatccagcaacatgattttcctggattggctatcaac
gataatttacaggatgcaaatcagatccaactgtatcatggcgccccttatatttttaca
tttggggatgtggacaaacacaatcagcaatga

DBGET integrated database retrieval system