KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0998
Entry
G2583_0998        CDS       T01190                                 
Symbol
nleH
Name
(GenBank) non-LEE-encoded type III effector H
  KO
K16042  non-LEE-encoded effector NleH
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_0998 (nleH)
SSDB
Motif
Pfam: DUF6673
Other DBs
NCBI-ProteinID: ADD55601
UniProt: D3QNI6
LinkDB
Position
1024512..1025393
AA seq 293 aa
MLSPYSVNLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDNGAQVKVGNRTYRVVATDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEVMLNASPVSAAMERGIVHSNRPDLPPVDYA
PPELPSVDYNRLSVPGNVIGKGGNAVVYEDAEDATKVLKMFTTSQSNEEVTSEVRCFNQY
YGAGSAEKIYGNNGDIIGIRMDKINGESLLNISSLPAQAEHAIYDMFDRLEQKGILFVDT
TETNVLYDRAKNEFNPIDISSYNVSDRSWSESQIMQSYHGGKQDLISVVLSKI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgttatcgccatattctgtaaatttgggatgttcatggaattctttaaccagaaacctg
acttcgcctgataatcgtgttttatcctctgtaagggatgctgccgttcattctgataat
ggggcgcaagtaaaggttggcaacagaacatatcgtgttgttgccaccgataataagttt
tgcgttacaagagaaagtcatagtggttgttttactaatctgttgcacaggctgggatgg
cctaagggggagattagcaggaaaattgaggtcatgctgaatgcatcaccagtgagcgct
gctatggaaagaggcattgttcattcgaacagacctgatttacctcctgttgattatgca
ccgccagagttaccgagtgtggactataacaggttgtcagtacctggtaatgttattggc
aaaggggggaacgctgtagtatatgaagatgctgaggatgcaacaaaagtcctgaagatg
tttactacatctcaaagcaatgaagaggtgacaagcgaagttcgttgcttcaaccaatat
tatggtgccgggagtgcagaaaaaatatatggcaataatggtgatattattggtattaga
atggataaaataaatggagaatcgcttttaaatatttcgtccttgccagcacaggctgag
catgctatttacgatatgtttgatagactggagcaaaaaggaattctttttgtcgataca
acagagacaaatgtcttatatgaccgcgcgaagaatgagtttaatccaatagatatatca
tcttataatgtttccgaccgttcatggagtgaaagtcaaataatgcaatcttatcatggc
ggaaagcaagatcttattagtgtggtattaagtaaaatttag

KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_1592
Entry
G2583_1592        CDS       T01190                                 
Symbol
nleH
Name
(GenBank) Non-LEE-encoded type III effector H
  KO
K16042  non-LEE-encoded effector NleH
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_1592 (nleH)
SSDB
Motif
Pfam: DNA_primase_S DUF6673
Other DBs
NCBI-ProteinID: ADD56174
UniProt: D3QRM2
LinkDB
Position
1623813..1624724
AA seq 303 aa
MLSPSSINLGCSWNSLTRNLTSPDNRVLSSVRDAAVHSDSGTQVTVGNRTYRVVVTDNKF
CVTRESHSGCFTNLLHRLGWPKGEISRKIEAMLNTSPVSTTIERGSVHSNRPDLPPVDYA
QPELPPADYTQSELPRVSNNKSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEV
TSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRL
EKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVL
SKI
NT seq 912 nt   +upstreamnt  +downstreamnt
atgttatcgccctcttctataaatttgggatgttcatggaattctttaaccagaaacctg
acttcgcctgataatcgtgttttatcctctgtaagggatgctgctgttcactctgatagc
gggacgcaagtaacggttggcaacagaacatatcgtgttgtggtcactgataataagttt
tgcgttacaagagaaagtcatagtggttgttttactaatctgttgcacaggttgggatgg
cctaagggagagattagcagaaaaattgaggctatgctgaatacatcgccagtgagcacg
actatagaaagaggctctgttcattcgaacagacctgatttacctccagtggattatgcg
cagccggagttacctccagcggattatactcagtcagagttgccgagggttagcaacaat
aaatcacccgtgccaggtaatgttattggtaaaggtggtaatgctgtcgtgtatgaagat
atggaagatacaacaaaagtgttgaagatgtttactatatctcaaagccatgaagaggtg
acaagcgaagttcgttgtttcaatcagtattatggttccgggagtgcagagaaaatatat
aatgataatggaaatgttattggtattagaatgaataaaataaatggggaatctcttttg
gatattccatcattaccagcacaagctgaacaggctatttacgatatgtttgacagactg
gagaaaaaaggaattctttttgttgatacaacagagacaaatgttttatatgatcgtatg
agaaatgaatttaatccaatagatatatcatcttataatgtttctgatatttcatggagt
gaacatcaagtcatgcaatcttatcacggaggaaagctggatcttattagtgtagtatta
agtaagatataa

DBGET integrated database retrieval system