KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_1593
Entry
G2583_1593        CDS       T01190                                 
Symbol
nleF
Name
(GenBank) hypothetical protein
  KO
K23658  T3SS secreted effector NleF
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_1593 (nleF)
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-ProteinID: ADD56175
UniProt: D3QRM3
LinkDB
Position
1624790..1625359
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNN
ELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSL
KVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLT
YNKGSLQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggttcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgagcttaatcataatcactttctttctcct
gaattacaagataaacttgatgttatggtctctatatattcatgtgccagaaataataat
gagcttgaggaaatttttcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcgctgagggcg
ggaatgacgatagaggatagggatagttatatcagggatcttttttttctgcattcattg
aaagtaaaaattgaggaaagtagacaaggcaaagaagattcgaaatgtaaagtttataat
ctgctatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgcctc
gtggaaggatgcagtgatgattttaatccttttgatattattagggtaccagatcttact
tacaacaaaggatctttacaatgtggatga

DBGET integrated database retrieval system