KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_1778
Entry
G2583_1778        CDS       T01190                                 
Symbol
gapC
Name
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase C
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00010  Glycolysis / Gluconeogenesis
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01200  Carbon metabolism
eok01230  Biosynthesis of amino acids
eok05130  Pathogenic Escherichia coli infection
Module
eok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eok_M00002  Glycolysis, core module involving three-carbon compounds
eok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_1778 (gapC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_1778 (gapC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eok04131]
    G2583_1778 (gapC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eok04147]
    G2583_1778 (gapC)
Enzymes [BR:eok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     G2583_1778 (gapC)
Membrane trafficking [BR:eok04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G2583_1778 (gapC)
Exosome [BR:eok04147]
 Exosomal proteins
  Proteins found in most exosomes
   G2583_1778 (gapC)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C NAD_binding_3 FTO_NTD
Other DBs
NCBI-ProteinID: ADD56355
UniProt: D3QSI6
LinkDB
Position
complement(1811691..1812692)
AA seq 333 aa
MSKVGINGFGRIGRLVLRRLLEVKSNIDVVAINDLTSPKILAYLLKHDSNYGPFPWSVDF
TEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLIS
APAGEMKTIVYKVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYT
GTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSV
TELVSILGKKVTAEEVNNALKQATTNNESFGYTDEEIVSSDIIGSHFGSVFDATQTEITA
VGDLQLVKTVAWYDNEYGFVTQLIRTLEKFAKL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagtaaagttggtattaacggttttggtcgtatcggtcgactggtgttgcgtcgatta
cttgaagtcaaaagcaacatagacgttgtcgctattaatgatcttacttccccaaaaatt
ctcgcctatctgctgaaacatgattcaaactatggtccgttcccctggagcgttgatttt
acggaagattcacttatcgttgatgggaaaagtatcgcggtttacgccgaaaaagaggct
aaaaatattccgtggaaagcgaaaggtgcagaaatcattgtcgaatgtactggcttttat
acctccgccgagaaatcgcaggcgcatcttgatgctggcgcgaagaaggtgttgatttcc
gcccctgcaggtgaaatgaaaactatcgtttataaagtcaatgacgacactctggatggc
aacgacaccattgtttccgtggcatcatgcactactaactgtcttgcgccgatggccaaa
gccttgcatgacagtttcgggatagaagtcggcacgatgacgaccattcatgcctatact
ggcacccagtcactggtggatggcccgcgtggtaaagatttacgtgcttcacgcgccgcg
gcagaaaatatcattccccacactacgggcgcggcaaaagccattggtctggtgatcccg
gaactgagcggcaaactgaaaggtcatgcgcaacgcgtgccggtgaaaacaggttcggtc
actgaactggtatcgattctcggaaaaaaagtgactgccgaagaggtgaataacgcactt
aaacaagcaaccaccaataacgagtcatttggttataccgatgaagaaatagtctcttcc
gatatcattggcagccatttcggttcggtgtttgatgccacgcaaacggaaattaccgcc
gtgggcgatttacaactggtgaaaacggtcgcctggtacgacaacgaatatggcttcgtc
acgcagcttattcgcaccctcgaaaaattcgctaaactctga

KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2226
Entry
G2583_2226        CDS       T01190                                 
Symbol
gapA
Name
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase A
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00010  Glycolysis / Gluconeogenesis
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01200  Carbon metabolism
eok01230  Biosynthesis of amino acids
eok05130  Pathogenic Escherichia coli infection
Module
eok_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eok_M00002  Glycolysis, core module involving three-carbon compounds
eok_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G2583_2226 (gapA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_2226 (gapA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eok04131]
    G2583_2226 (gapA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eok04147]
    G2583_2226 (gapA)
Enzymes [BR:eok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     G2583_2226 (gapA)
Membrane trafficking [BR:eok04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G2583_2226 (gapA)
Exosome [BR:eok04147]
 Exosomal proteins
  Proteins found in most exosomes
   G2583_2226 (gapA)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ADD56793
UniProt: D3QVP4
LinkDB
Position
2255331..2256326
AA seq 331 aa
MTIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDLLDADYMAYMLKYDSTHGRFDGTVEV
KDGHLIVNGKKIRVTAERDPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMT
GPSKDNTPMFVKGANFDKYAGQDIVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATT
ATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSV
VDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIA
LNDNFVKLVSWYDNETGYSNKVLDLIAHISK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgactatcaaagtaggtatcaacggttttggccgtatcggtcgcattgttttccgtgct
gctcagaaacgttctgacatcgagatcgttgcaatcaacgacctgttagacgctgattac
atggcatacatgctgaaatatgactccactcacggccgtttcgacggtaccgttgaagtg
aaagacggtcatctgatcgttaacggtaaaaaaatccgtgttaccgctgaacgtgatccg
gctaacctgaaatgggacgaagttggtgttgacgttgtcgctgaagcaactggtctgttc
ctgactgacgaaactgctcgtaaacacatcaccgctggtgcgaagaaagtggttatgact
ggtccgtctaaagacaacactccgatgttcgttaaaggcgctaacttcgacaaatatgct
ggccaggacatcgtttccaacgcttcctgcaccaccaactgcctggctccgctggctaaa
gttatcaacgataacttcggcatcatcgaaggtctgatgaccaccgttcacgctactacc
gctactcagaaaaccgttgatggcccgtctcacaaagactggcgcggcggccgcggcgct
tcccagaacatcatcccgtcctctaccggtgctgctaaagctgtaggtaaagtactgcca
gaactgaatggcaaactgactggtatggcgttccgcgttccgaccccgaacgtatccgta
gttgacctgaccgttcgtctggaaaaagctgcaacttacgagcagatcaaagctgccgtt
aaagctgctgctgaaggcgaaatgaaaggcgttctgggctacaccgaagatgacgtagta
tctaccgatttcaacggcgaagtttgcacttccgtgttcgatgctaaagctggtatcgct
ctgaacgacaacttcgtgaaactggtatcctggtacgacaacgaaaccggttactccaac
aaagttctggacctgatcgctcacatctctaaataa

DBGET integrated database retrieval system