KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_3639
Entry
G2583_3639        CDS       T01190                                 
Symbol
nleE
Name
(GenBank) ST47 protein
  KO
K23654  T3SS secreted effector NleE
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_3639 (nleE)
SSDB
Motif
Pfam: Arm-DNA-bind_2
Other DBs
NCBI-ProteinID: ADD58132
UniProt: D3QR82
LinkDB
Position
3688566..3689240
AA seq 224 aa
MINPVTNTQGVSPINTKYAEHVVKNIYPEIKHDYFNESPNIYDKKYISGITRGVAELKQE
EFVNEKARRFSYMKTMYSVCPEAFEPISRNEASTPEGSWLTVISGKRPMGQFSVDSLYNP
DLHALCELPDICCKIFPKENNDFLYIVVVYRNDSPLGEQRANRFIELYNIKRDIMQELNY
ELPELKAVKSEMIIAREMGEIFSYMPGEIDSYMKYINNKLSKIE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgattaatcctgttactaatactcagggcgtgtcccctataaatactaaatatgctgaa
catgtggtgaaaaatatttacccggaaattaaacatgattactttaatgaatcacccaat
atatatgataagaagtatatatccggtataaccagaggagtagctgaactaaaacaggaa
gaatttgttaacgagaaagccagacggttttcttatatgaagactatgtattctgtatgt
ccagaagcgtttgaacctatttccagaaatgaagccagtacaccggaaggaagctggcta
acagttatatccggaaaacgcccaatggggcagttttctgtagatagtttatacaatcct
gatttacatgcattatgtgagcttccggacatttgttgtaagatcttccctaaagaaaat
aatgattttttatacatagttgttgtgtacagaaatgacagccctctaggagaacaacgg
gcaaatagatttatagaattatataatataaaaagagatatcatgcaggaattaaattat
gagttaccagagttaaaggcagtaaaatctgaaatgattatcgcacgtgaaatgggagaa
atctttagctacatgcctggggaaatagacagttatatgaaatacataaataataaactt
tctaaaattgagtag

DBGET integrated database retrieval system