KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4409
Entry
G2583_4409        CDS       T01190                                 
Symbol
espB
Name
(GenBank) Secreted protein EspB
  KO
K23650  LEE-encoded effector EspB
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4409 (espB)
SSDB
Motif
Pfam: EspB DUF4064 CATRA-C
Other DBs
NCBI-ProteinID: ADD58876
UniProt: D3QW15
LinkDB
Position
complement(4478553..4479491)
AA seq 312 aa
MNTIDNTQVTMVNSASESTTGASSAVAASALSIDSSLLTDGKVDICKLMLEIQKLLGKMV
TLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGIISSALGILGSFAAMNN
AAKGAGEIAEKASSASSKAAGAASEVANKALVKATESVADVAEEASSAMQKAMATTTKAA
SRASGVADDVAKASDFAEDLADAAEKTSRINKLLNSVDKLTNTTAFVAVTSLAEGTKTLP
TTISESVKSTHEVNEQRAKSLENFQQGNLELYKQDVRRTQDDITTRLRDITSAVRDLLEV
QNRMGQSGRLAG
NT seq 939 nt   +upstreamnt  +downstreamnt
atgaatactattgataatactcaagtaacgatggttaattccgcttcggagagtacgacc
ggcgcttccagtgcagttgccgcatctgctttatcaattgattcatctctgcttactgat
ggtaaggttgatatttgtaagctgatgctggaaattcaaaaactcctcggcaagatggtg
actctattgcaggattaccaacaaaaacaattggcgcaaagctatcagattcagcaggcc
gtttttgagagccagaataaagctattgaggaaaaaaaagccgcggcaaccgctgctttg
gttggcgggattatttcatcagcattggggatcttaggttcttttgcagcaatgaacaac
gcggctaaaggggctggtgagattgctgaaaaagcaagctctgcatcttcaaaggctgct
ggtgcggcttctgaggttgcaaataaagctctggtcaaggctacggaaagtgttgctgat
gtcgcagaggaggcatccagtgcgatgcagaaagcgatggccacaacaacgaaagcagcc
agccgtgcatctggcgttgcagatgatgttgcgaaagcctctgactttgctgaagatctt
gcagacgccgccgagaagacaagcagaatcaataagttgttgaattccgtagataaactg
accaataccacagcatttgttgccgtgaccagtcttgctgaaggtacgaaaacgttgcca
acaacaatctctgagtccgtcaaatcgactcatgaggttaatgaacaacgtgcgaagtcg
ctggaaaacttccagcaggggaatctggagctgtataaacaagacgttcgcagaacgcag
gatgatatcacgactcgtctgcgtgatataacgtccgctgtccgcgatctccttgaggtc
cagaatcgtatggggcaatcgggtcgcttagctgggtaa

DBGET integrated database retrieval system